close all open/close all

CDS information : Rifam_00060


close this sectionLocation

Organism
StrainS699
Entry nameRifamycin
Contig
Start / Stop / Direction4,360 / 5,685 / + [in whole cluster]
4,360 / 5,685 / + [in contig]
Location4360..5685 [in whole cluster]
4360..5685 [in contig]
TypeCDS
Length1,326 bp (441 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.2 function unknown
Productmammalian cell entry family protein
Product (GenBank)putative secreted protein
Gene
Gene (GenBank)
EC number
Keyword
  • mce operon
Note
Note (GenBank)
  • ORF24
Reference
ACC
Family/Domain
FD
IPR005693

close this sectionSequence

selected fasta
>mammalian cell entry family protein [putative secreted protein]
MRTLRRRLLGLLLIAVMVGGVALSIALYDKAFTPVVTVRLQADKIGNQLIKQSDVKVRGL
IVGSVQDIVATDHGAELTLALQPESAKLIPENVSARFLPKTLFGERFVSLEIPKDPSAKT
IADGDVIPQDRTSSAIELDQAFEHLMPVLQAVQPQKLSATLTAISTALQGRGDQLGDTLS
QLGTYIGELNPHEPELQHNLKALAEFSDHLKDAAPDLVQSLDNLSTTTRTVVDERQNLSN
LYGSLTQASVDLQTFLQNNKDNIISLVDTARPTAELLAKYAPEYPCVISQMAKNVPLIDQ
ALGKGTNQPGLHATIEIIVPRAPYQAGKEEPRFDDKRGPRCYDIKDIPKPFPSEPPDGAF
KDGTLHQAAPKSVGEGLNPAKFKADSAGNGGSGGDLAYSTAEQGFLADLLGPQLGMSAAD
VPGWSSLLVGPLYRGAEVTVK
selected fasta
>mammalian cell entry family protein [putative secreted protein]
ATGAGGACGCTCCGACGCAGGCTGCTCGGCCTGCTGCTCATCGCCGTGATGGTCGGCGGG
GTGGCGCTGTCCATCGCGCTCTACGACAAGGCGTTCACCCCGGTCGTCACGGTCAGGCTG
CAGGCCGACAAGATCGGCAACCAGCTGATCAAGCAGTCCGACGTCAAGGTGCGCGGCCTG
ATCGTCGGCTCGGTGCAGGACATCGTCGCCACCGACCACGGCGCCGAGCTGACCCTGGCG
CTCCAGCCGGAGTCCGCGAAGCTCATCCCGGAGAACGTCTCGGCGCGGTTCCTGCCCAAG
ACGCTCTTCGGCGAGCGGTTCGTCTCGCTGGAGATCCCGAAGGACCCGTCGGCCAAGACG
ATCGCAGACGGCGACGTCATCCCGCAGGACCGCACGTCGAGCGCGATCGAGCTGGACCAG
GCCTTCGAGCACCTGATGCCGGTGCTGCAGGCGGTGCAGCCGCAGAAGCTGTCGGCGACG
CTCACCGCGATCTCGACCGCGCTGCAGGGCCGCGGCGACCAGCTCGGCGACACGCTCTCG
CAGCTGGGCACCTACATCGGCGAGCTGAACCCGCACGAGCCGGAGCTGCAGCACAACCTC
AAGGCGCTCGCGGAGTTCTCCGACCACCTCAAGGACGCGGCCCCGGACCTGGTGCAGAGC
CTGGACAACCTGAGCACGACAACCCGCACCGTGGTCGACGAGCGGCAGAACCTGTCGAAC
CTCTACGGCAGCCTGACCCAGGCCTCGGTGGACCTGCAGACGTTCCTGCAGAACAACAAG
GACAACATCATCTCCCTCGTCGACACCGCCCGGCCGACGGCCGAACTGCTGGCGAAGTAC
GCGCCGGAGTACCCCTGCGTGATCTCCCAGATGGCCAAGAACGTGCCGCTGATCGACCAG
GCGCTCGGCAAGGGCACCAACCAGCCCGGCCTGCACGCGACCATCGAGATCATCGTCCCG
CGCGCGCCGTACCAGGCGGGCAAGGAAGAGCCGCGGTTCGACGACAAGCGCGGCCCGCGC
TGCTACGACATCAAGGACATCCCGAAGCCGTTCCCGTCCGAGCCGCCGGACGGCGCGTTC
AAGGACGGCACGCTGCACCAGGCCGCGCCGAAGAGCGTCGGCGAGGGCCTCAACCCGGCC
AAGTTCAAGGCGGACTCGGCCGGCAACGGCGGCAGCGGTGGTGATCTGGCGTACTCGACG
GCGGAGCAGGGCTTCCTGGCCGACCTGCTCGGCCCGCAGCTGGGCATGAGCGCCGCGGAC
GTCCCGGGCTGGAGCTCGCTGCTCGTCGGCCCGCTGTACCGGGGTGCGGAGGTGACGGTC
AAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003399 Mammalian cell entry-related (Domain)
 [36-111]  1.3e-09 PF02470
PF02470   MCE
IPR005693 Mammalian cell entry (Family)
 [9-292]  2.7e-60 TIGR00996
TIGR00996   Mtu_fam_mce: virulence factor Mce family protein
IPR024516 Mammalian cell entry, C-terminal (Domain)
 [143-432]  8.7e-79 PF11887
PF11887   DUF3407
SignalP
 [1-42]  1 Signal
Bacteria, Gram-positive   
 [1-24]  0.999 Signal
Bacteria, Gram-negative   
 [1-24]  0.797 Signal
Eukaryota   
TMHMM
 [7-29]  Transmembrane (i-o)
Transmembrane 1