close all open/close all

CDS information : Rifam_00080


close this sectionLocation

Organism
StrainS699
Entry nameRifamycin
Contig
Start / Stop / Direction6,707 / 7,693 / + [in whole cluster]
6,707 / 7,693 / + [in contig]
Location6707..7693 [in whole cluster]
6707..7693 [in contig]
TypeCDS
Length987 bp (328 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.2 function unknown
Productmammalian cell entry family protein
Product (GenBank)putative lipoprotein
Gene
Gene (GenBank)
EC number
Keyword
  • mce operon
Note
Note (GenBank)
  • ORF26
Reference
ACC
Family/Domain
FD
IPR005693

close this sectionSequence

selected fasta
>mammalian cell entry family protein [putative lipoprotein]
MKSFQKRNPVPIALVGIVVLALAFTAALNSDDLPVIGGGTTYSAEFSEASGLQKDNDVRI
AGVKVGKVSDIALDGASVKVSFKVKDAWLGDRTSAAIKIKTLLGQKYLSLDPQGETALNP
GTGIPRDRTMAPYDVLDAFRGLSQTVDNIDTKQLAQSFDTISQTFANTPQDVKGALSGLS
KLSDTIASRDQQLSNLLANTRQVSQTLVDRDAEVQKLLDDGNDLLAELAKREDAITALLD
GSRELATQLQGLIDDNGKQLDPVLTQLDQLTSMLQRNQDSLAEGLKKFAPFIRVFTNTIG
NGRWFDNYICGLLLPSFGPINEEGCYTK
selected fasta
>mammalian cell entry family protein [putative lipoprotein]
ATGAAGTCCTTCCAGAAGCGCAACCCCGTGCCGATCGCGCTGGTCGGGATCGTCGTGCTG
GCGCTCGCCTTCACCGCCGCGCTCAACTCCGACGACCTGCCGGTGATCGGCGGGGGCACC
ACCTACAGCGCCGAGTTCAGCGAGGCTTCCGGGCTGCAGAAGGACAACGACGTCCGGATC
GCCGGCGTCAAGGTCGGCAAGGTCAGCGACATCGCGCTCGACGGCGCGTCGGTGAAGGTG
TCTTTCAAGGTCAAGGACGCCTGGCTGGGCGACCGGACCAGTGCCGCGATCAAGATCAAG
ACGTTGCTCGGGCAGAAGTACCTGTCGCTGGACCCGCAGGGTGAGACCGCGCTGAACCCG
GGCACCGGCATCCCGCGCGACCGCACGATGGCACCCTACGACGTGCTCGACGCCTTCCGC
GGGCTGTCCCAGACCGTCGACAACATCGACACCAAGCAGCTGGCGCAGAGCTTCGACACG
ATCTCGCAGACCTTCGCCAACACGCCGCAGGACGTGAAGGGCGCGCTGTCGGGGCTGTCG
AAGCTGTCGGACACGATCGCCTCGCGCGACCAGCAGCTGTCGAACCTGCTGGCCAACACC
CGCCAGGTGTCGCAGACGCTGGTCGACCGCGACGCCGAGGTGCAGAAGCTGCTCGACGAC
GGCAACGACCTGCTCGCCGAGCTGGCCAAGCGCGAGGACGCGATCACCGCGCTGCTGGAC
GGCTCCCGCGAGCTGGCCACCCAGCTGCAGGGCCTGATCGACGACAACGGAAAGCAGCTC
GACCCGGTGCTGACCCAGCTCGACCAGCTGACGTCGATGCTGCAGCGCAACCAGGACTCC
CTCGCCGAGGGGCTCAAGAAGTTCGCGCCGTTCATCCGCGTCTTCACCAACACCATCGGC
AACGGCCGCTGGTTCGACAACTACATCTGCGGCCTGCTGCTGCCGTCGTTCGGCCCGATC
AACGAAGAGGGGTGCTACACGAAATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003399 Mammalian cell entry-related (Domain)
 [39-112]  5.6e-15 PF02470
PF02470   MCE
IPR005693 Mammalian cell entry (Family)
 [12-291]  7.1e-62 TIGR00996
TIGR00996   Mtu_fam_mce: virulence factor Mce family protein
IPR008360 Mammalian cell entry, mce1C (Family)
 [28-48]  9.7e-14 PR01782 [90-106]  9.7e-14 PR01782 [128-152]  9.7e-14 PR01782 [177-195]  9.7e-14 PR01782 [246-265]  9.7e-14 PR01782 [297-316]  9.7e-14 PR01782
PR01782   MCEVIRFACTOR
SignalP
 [1-27]  0.888 Signal
Eukaryota   
 [1-30]  1 Signal
Bacteria, Gram-negative   
 [1-30]  1 Signal
Bacteria, Gram-positive   
TMHMM
 [9-28]  Transmembrane (i-o)
Transmembrane 1