close all open/close all

CDS information : Rifam_00120


close this sectionLocation

Organism
StrainS699
Entry nameRifamycin
Contig
Start / Stop / Direction11,346 / 11,921 / + [in whole cluster]
11,346 / 11,921 / + [in contig]
Location11346..11921 [in whole cluster]
11346..11921 [in contig]
TypeCDS
Length576 bp (191 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative membrane protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF30
Reference
ACC

close this sectionSequence

selected fasta
>hypothetical protein [putative membrane protein]
MSTDEPAATSVAEESSAAPPKDASRTLVLGAAALALAALIAAAIFGVQWWMAANDDNAGL
AASREAVVKAGTNALKAYTEVDYTDLDGFFTRQKAVSDEKMSQQIDQSAPTFRKALADAK
TKVTTDVQDVAVEELDDHEGKASFLAAIATTVTQGDKSSAKPLRLEVSMSKVGEDWKLSG
IDSVPLVAAGQ
selected fasta
>hypothetical protein [putative membrane protein]
ATGAGCACGGACGAGCCGGCCGCCACGTCGGTAGCGGAAGAGTCTTCCGCGGCGCCGCCG
AAGGACGCCTCGCGGACCCTGGTGCTCGGCGCCGCGGCACTGGCACTGGCCGCCCTCATC
GCGGCGGCGATCTTCGGCGTCCAGTGGTGGATGGCCGCGAACGACGACAACGCCGGCCTG
GCGGCGTCGCGCGAGGCCGTGGTGAAGGCGGGCACCAACGCGCTGAAGGCCTACACCGAG
GTCGACTACACCGATCTCGACGGCTTCTTCACCCGGCAGAAGGCCGTGTCGGACGAGAAG
ATGTCGCAGCAGATCGACCAGTCGGCGCCGACGTTCCGCAAGGCCCTCGCCGACGCCAAG
ACGAAGGTCACCACGGACGTCCAGGACGTCGCCGTCGAGGAGCTGGACGACCACGAAGGC
AAGGCCAGCTTCCTCGCCGCCATCGCCACCACCGTCACCCAGGGGGACAAGAGCAGCGCG
AAGCCGTTGCGCCTCGAAGTCTCGATGAGCAAGGTGGGCGAGGATTGGAAGCTGTCCGGC
ATCGACAGCGTCCCGCTCGTCGCGGCCGGCCAGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-43]  0.368 Signal
Bacteria, Gram-positive   
 [1-1]  Signal-anchor
Eukaryota   
TMHMM
 [28-50]  Transmembrane (o-i)
Transmembrane 1