close all open/close all

CDS information : Rifam_00130


close this sectionLocation

Organism
StrainS699
Entry nameRifamycin
Contig
Start / Stop / Direction11,944 / 12,981 / + [in whole cluster]
11,944 / 12,981 / + [in contig]
Location11944..12981 [in whole cluster]
11944..12981 [in contig]
TypeCDS
Length1,038 bp (345 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative integral membrane protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF31
Reference
ACC

close this sectionSequence

selected fasta
>hypothetical protein [putative integral membrane protein]
MPPSRRQPPRSTPSPSRRPRVAGLRKPPTDETAAERTGQLPAVPPAKPRPRPAPRPAPRP
AAKPAEPVESTSGQLDDLAPAEDTQVFAAVGTEVEEEPRVDALTGEPSADEEEAPARPAP
RRKKRDTGIAKPTEESEVPVSAADPEPEKRAGAKVPKTYLVAGALVLVALILGGLAFWFK
SEEVKVSSATSNTALLDVAKTAQVKDAVSKAAEALFSYDFNNIKKTEDAANDLLANDDVK
NKYNSLMGEVKRLAPAQKMIVTCKVTRAAVIMLNGDLAKVMVFVDQTSTRTDTKKTTAGT
AQLHLNAQLQGDKWKITDMDTYNAPKVPAASQAPASAPASPTPSK
selected fasta
>hypothetical protein [putative integral membrane protein]
GTGCCCCCCTCCCGCCGCCAGCCGCCGCGCAGCACCCCGTCGCCGTCGCGGCGTCCCCGC
GTGGCCGGGCTGCGCAAGCCCCCGACGGACGAGACCGCCGCCGAGCGGACCGGTCAGCTG
CCCGCCGTGCCGCCCGCGAAGCCGCGTCCGCGGCCGGCGCCGCGTCCGGCGCCCCGGCCG
GCCGCCAAGCCCGCCGAGCCGGTGGAGTCCACCAGCGGGCAGCTCGACGACCTGGCGCCG
GCCGAGGACACGCAGGTGTTCGCGGCGGTCGGCACCGAGGTCGAAGAGGAGCCGCGGGTC
GACGCGCTCACGGGGGAGCCATCGGCCGACGAGGAGGAGGCCCCGGCGCGGCCGGCGCCG
CGGCGGAAGAAGCGGGACACCGGGATCGCGAAGCCGACCGAGGAATCCGAGGTTCCGGTC
TCGGCTGCCGATCCGGAGCCGGAGAAGCGCGCGGGCGCGAAGGTGCCGAAGACGTACCTC
GTGGCGGGTGCGCTGGTGCTGGTCGCGCTGATCCTGGGCGGGCTGGCGTTCTGGTTCAAG
TCCGAAGAGGTCAAGGTCTCCTCGGCTACGAGCAACACGGCGCTGCTGGACGTCGCGAAG
ACCGCGCAGGTCAAGGACGCGGTGTCGAAGGCGGCCGAGGCGCTGTTCTCCTACGACTTC
AACAACATCAAGAAGACCGAGGACGCGGCGAACGACCTGCTCGCCAACGACGACGTCAAG
AACAAGTACAACTCGCTGATGGGCGAGGTGAAGCGGCTCGCGCCGGCCCAGAAGATGATC
GTGACGTGCAAGGTGACGCGCGCGGCGGTGATCATGCTGAACGGCGACCTGGCGAAGGTG
ATGGTCTTCGTCGACCAGACCTCGACCCGCACCGACACGAAGAAGACGACGGCGGGCACG
GCCCAGCTCCACCTGAACGCCCAGCTCCAGGGCGACAAGTGGAAGATCACCGACATGGAC
ACCTACAACGCCCCGAAGGTGCCGGCGGCGTCGCAGGCACCCGCGTCGGCGCCGGCTTCC
CCGACGCCGTCGAAGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-22]  0.541 Signal
Bacteria, Gram-negative   
 [1-24]  0.593 Signal
Bacteria, Gram-positive   
TMHMM
 [159-178]  Transmembrane (i-o)
Transmembrane 1