close all open/close all

CDS information : Rifam_00140


close this sectionLocation

Organism
StrainS699
Entry nameRifamycin
Contig
Start / Stop / Direction14,020 / 12,998 / - [in whole cluster]
14,020 / 12,998 / - [in contig]
Locationcomplement(12998..14020) [in whole cluster]
complement(12998..14020) [in contig]
TypeCDS
Length1,023 bp (340 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF32
Reference
ACC

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MPVKKNAKLLTRPVELWARAFETLGDAGYGIATEDDEVPFEFGMLFPDFLGGLQMTLYSA
GGTPMPLELLYGLADQMPSLVAGLELREDSQWRYALRATLAVLDRLGAIERTEADAVELA
KIAELTGRPEPDPTLVSLTPLALWALNRMLRDEGADAPVVGELATAPLETLCAHVADAPP
EIAEAEVAAWVAHRSPADAAAEAVDFLREAEGPAQRLFALLTLGAAGDAGVADARTVREE
GGIAGAVMAAWLAERSETTAESLTSEELCLSMTDHLAAMDELGVLFDELAALGDPSSIVG
VIAAADHPARLRLLDVIAQEHPDRKIAKRARKARFTLRQG
selected fasta
>hypothetical protein [hypothetical protein]
GTGCCGGTCAAGAAGAACGCGAAACTGCTCACGCGGCCGGTGGAACTGTGGGCCCGCGCG
TTCGAAACGCTCGGCGATGCGGGCTACGGTATCGCCACCGAGGACGATGAGGTGCCGTTC
GAGTTCGGGATGCTGTTCCCGGACTTCCTCGGCGGTCTGCAGATGACGCTGTATTCCGCG
GGCGGCACGCCGATGCCGCTGGAGCTGCTGTACGGACTGGCCGACCAGATGCCGTCCTTG
GTGGCGGGGCTCGAACTCCGCGAGGATTCACAGTGGCGCTACGCCCTCCGGGCGACCCTG
GCGGTACTGGACCGCCTCGGCGCGATCGAGCGGACCGAGGCCGACGCGGTAGAGCTCGCC
AAGATCGCCGAACTCACCGGCCGTCCCGAACCCGATCCGACCCTCGTGAGCTTGACCCCG
CTCGCTCTGTGGGCACTGAACCGGATGCTCCGCGACGAGGGCGCCGACGCGCCGGTCGTC
GGGGAACTGGCCACGGCTCCGCTCGAAACCCTCTGTGCGCACGTGGCTGACGCGCCGCCG
GAAATCGCCGAAGCCGAAGTGGCCGCGTGGGTGGCCCACCGGTCCCCGGCGGACGCCGCC
GCGGAAGCCGTCGATTTCCTCCGGGAGGCGGAGGGCCCGGCGCAGCGGCTGTTCGCGTTG
CTGACGCTCGGCGCGGCCGGTGATGCCGGCGTCGCCGATGCGCGCACCGTCCGCGAAGAA
GGCGGCATCGCGGGCGCGGTCATGGCGGCCTGGCTGGCCGAACGCAGCGAGACGACGGCC
GAATCGCTGACTTCCGAGGAGTTGTGCCTGAGCATGACCGATCACCTCGCGGCGATGGAC
GAGCTCGGGGTGCTGTTCGACGAATTGGCCGCGCTGGGGGACCCGAGCTCCATCGTCGGT
GTGATCGCCGCGGCGGACCATCCGGCCCGGCTTCGCCTGCTGGACGTGATCGCTCAGGAG
CACCCGGACCGCAAGATCGCCAAGCGGGCCCGCAAGGCCCGGTTCACCCTGCGCCAGGGC
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit