close all open/close all

CDS information : Rifam_00160


close this sectionLocation

Organism
StrainS699
Entry nameRifamycin
Contig
Start / Stop / Direction14,341 / 15,309 / + [in whole cluster]
14,341 / 15,309 / + [in contig]
Location14341..15309 [in whole cluster]
14341..15309 [in contig]
TypeCDS
Length969 bp (322 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)RifS
Gene
Gene (GenBank)rifS
EC number
Keyword
Note
Note (GenBank)
  • putative NADH-dependent dehydrogenase
Reference
ACC
PmId
[9512878] Biosynthesis of the ansamycin antibiotic rifamycin: deductions from the molecular analysis of the rif biosynthetic gene cluster of Amycolatopsis mediterranei S699. (Chem Biol. , 1998)
Related Reference
ACC
Q2I8V6
PmId
[16461673] Catabolism of 1,5-anhydro-D-fructose in Sinorhizobium morelense S-30.7.5: discovery, characterization, and overexpression of a new 1,5-anhydro-D-fructose reductase and its application in sugar analysis and rare sugar synthesis. (Appl Environ Microbiol. , 2006)
ACC
Q9KWL3
PmId
[11073908] Genetic and biochemical characterization of 4-carboxy-2-hydroxymuconate-6-semialdehyde dehydrogenase and its role in the protocatechuate 4,5-cleavage pathway in Sphingomonas paucimobilis SYK-6. (J Bacteriol. , 2000)

close this sectionSequence

selected fasta
>putative oxidoreductase [RifS]
MALIGAGLIARLHLEAWLGAGAAVRVYSDDGRSRELAAEFGAKAAGSLEEALDGADAVDI
CTPTASHHEIALTAIAAGVGVVCEKPLAASAEEAEEIVTAAERAGVRLYAAHDVRFAAPY
ARLHELVASGRLGEGALGRFSFSAYHPRPWTGHASARSGGILTDQLLHGADLAHWVFGDV
VRVHACYQGDIATPAPEGAVATGTAVLTHASGAISQVVSRWTATPRPPVRVAFHVSGTGG
SVSYDSEWPQEVRVVDGGAGNFAYGGPSVFDTEMREFATAFAGGPEPRIGAKDALAAVRI
IHAAAESAWTGRAVELPVRGAA
selected fasta
>putative oxidoreductase [RifS]
GTGGCCCTGATCGGTGCGGGGCTCATCGCCCGGCTGCACCTGGAAGCGTGGCTCGGCGCC
GGCGCCGCCGTGCGGGTGTACTCCGACGACGGCCGGAGCCGCGAGCTGGCGGCGGAGTTC
GGCGCGAAGGCCGCCGGGTCCCTGGAAGAGGCGCTCGACGGCGCCGACGCCGTCGACATC
TGCACGCCGACCGCGAGCCACCACGAGATCGCCCTGACCGCCATCGCCGCCGGTGTCGGC
GTCGTGTGCGAGAAGCCGCTGGCGGCCAGCGCCGAAGAGGCCGAAGAGATCGTCACCGCC
GCCGAACGGGCCGGGGTGCGGCTCTACGCCGCCCACGACGTGCGGTTCGCGGCGCCCTAC
GCGCGATTGCACGAGCTCGTTGCGAGCGGGCGGCTCGGGGAGGGTGCCCTCGGCCGGTTC
TCCTTCTCCGCCTACCACCCGCGGCCCTGGACCGGGCACGCCTCCGCGCGGTCGGGCGGC
ATCCTCACCGACCAGCTGCTGCACGGCGCCGACCTCGCCCACTGGGTCTTCGGGGACGTC
GTCCGCGTGCACGCCTGCTACCAGGGCGACATCGCCACCCCGGCGCCCGAAGGGGCCGTC
GCGACCGGGACCGCCGTGCTCACCCACGCGAGCGGCGCCATCAGCCAGGTGGTGAGCCGG
TGGACGGCCACGCCGCGGCCGCCGGTGCGGGTGGCCTTCCACGTCTCGGGTACCGGCGGG
TCCGTCAGCTACGACTCCGAGTGGCCGCAGGAGGTCCGGGTCGTCGACGGCGGCGCCGGG
AACTTCGCTTACGGCGGGCCGTCGGTGTTCGACACCGAAATGCGGGAGTTCGCCACGGCT
TTCGCGGGTGGACCCGAGCCGAGGATCGGCGCGAAGGACGCGCTGGCCGCCGTGCGGATC
ATCCACGCCGCCGCCGAGTCCGCGTGGACCGGGCGGGCCGTCGAACTGCCGGTGAGGGGA
GCAGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000683 Oxidoreductase, N-terminal (Domain)
 [2-111]  4.9e-22 PF01408
PF01408   GFO_IDH_MocA
IPR004104 Oxidoreductase, C-terminal (Domain)
 [142-222]  6e-08 PF02894
PF02894   GFO_IDH_MocA_C
IPR016040 NAD(P)-binding domain (Domain)
 [2-129]  4.30000000000003e-33 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-22]  0.868 Signal
Eukaryota   
 [1-22]  0.232 Signal
Bacteria, Gram-positive   
TMHMM No significant hit