close all open/close all

CDS information : Rifam_00170


close this sectionLocation

Organism
StrainS699
Entry nameRifamycin
Contig
Start / Stop / Direction15,306 / 16,073 / + [in whole cluster]
15,306 / 16,073 / + [in contig]
Location15306..16073 [in whole cluster]
15306..16073 [in contig]
TypeCDS
Length768 bp (255 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)RifT
Gene
Gene (GenBank)rifT
EC number
Keyword
Note
Note (GenBank)
  • putative NADH-dependent dehydrogenase
Reference
ACC
PmId
[9512878] Biosynthesis of the ansamycin antibiotic rifamycin: deductions from the molecular analysis of the rif biosynthetic gene cluster of Amycolatopsis mediterranei S699. (Chem Biol. , 1998)

close this sectionSequence

selected fasta
>hypothetical protein [RifT]
MKVAILSSTPQAYAGALRGLPDVEVVAAASWDAFEPVRQAAEAGARVLCEYPPAAKETDL
KAMIDAAGDRLTFASPACHGEAFAVVRKGIADGGIGELTTVLGSVATSVDGVLGAAAPYL
LDLADAVLGGEPAQQVYAQTNIVLSGRIGESAAVLTVRYRSGQVASFDCRRHGSATGLPA
VTFIGDQGSVQYDAGPQLLGGERPELGGEDLEALMLKDFLGAGDGPGPDGQAALRTFRII
QAAYESAHTGQPVDL
selected fasta
>hypothetical protein [RifT]
GTGAAGGTCGCCATCCTGTCGTCCACGCCCCAGGCCTACGCCGGGGCGCTGCGCGGCCTG
CCGGACGTCGAAGTCGTGGCCGCGGCGAGCTGGGACGCGTTCGAGCCCGTCCGGCAAGCG
GCCGAGGCCGGCGCGCGCGTGCTGTGCGAATACCCGCCCGCGGCCAAGGAAACCGACCTG
AAAGCGATGATCGACGCCGCGGGCGACCGGCTCACGTTCGCGTCCCCGGCCTGCCACGGC
GAGGCGTTCGCCGTGGTGCGCAAGGGAATCGCCGACGGTGGCATCGGTGAGCTCACGACC
GTCCTCGGCTCGGTGGCCACGAGCGTGGACGGGGTGCTGGGTGCCGCCGCGCCGTACCTG
CTCGACCTGGCGGACGCCGTTCTCGGTGGTGAGCCCGCGCAGCAGGTGTACGCCCAGACC
AACATCGTCCTCAGTGGACGGATCGGGGAAAGCGCGGCGGTGCTGACCGTGCGGTACCGG
AGCGGGCAGGTCGCGTCGTTCGACTGCCGCCGCCACGGTTCCGCGACGGGACTGCCGGCC
GTCACCTTCATCGGGGACCAGGGGAGCGTCCAGTACGACGCCGGTCCGCAGCTGCTCGGC
GGCGAGCGGCCCGAACTGGGTGGCGAAGACCTGGAGGCGTTGATGCTCAAGGACTTCCTG
GGTGCCGGGGACGGGCCCGGACCGGACGGTCAGGCCGCTCTGCGGACGTTCCGGATCATC
CAAGCGGCCTACGAATCGGCGCACACGGGGCAGCCCGTCGACCTGTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR016040 NAD(P)-binding domain (Domain)
 [22-115]  5.3e-07 G3DSA:3.40.50.720
G3DSA:3.40.50.720   no description
SignalP
 [1-14]  0.386 Signal
Bacteria, Gram-negative   
 [1-28]  0.314 Signal
Bacteria, Gram-positive   
TMHMM No significant hit