close all open/close all

CDS information : Rifam_00190


close this sectionLocation

Organism
StrainS699
Entry nameRifamycin
Contig
Start / Stop / Direction16,250 / 16,477 / + [in whole cluster]
16,250 / 16,477 / + [in contig]
Location16250..16477 [in whole cluster]
16250..16477 [in contig]
TypeCDS
Length228 bp (75 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF35
Reference
ACC
PmId
[9512878] Biosynthesis of the ansamycin antibiotic rifamycin: deductions from the molecular analysis of the rif biosynthetic gene cluster of Amycolatopsis mediterranei S699. (Chem Biol. , 1998)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MEAAMSVTQVKIALSGGPAELAPAHRSVDSGALENTLKIRHGAGYEHFVHGGEFQAVDGC
DIAVFRWSHRTKIAE
selected fasta
>hypothetical protein [hypothetical protein]
GTGGAGGCCGCGATGAGTGTTACGCAGGTGAAAATCGCGTTGAGCGGTGGACCGGCCGAA
CTGGCGCCGGCGCACCGCAGCGTCGACTCCGGCGCGCTGGAGAACACGCTCAAGATCCGC
CACGGGGCCGGTTACGAGCATTTCGTGCACGGCGGCGAATTCCAGGCCGTCGACGGCTGC
GACATCGCGGTCTTCCGGTGGTCGCACCGCACGAAGATCGCCGAATAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-24]  0.267 Signal
Bacteria, Gram-positive   
TMHMM No significant hit