close all open/close all

CDS information : Rifam_00200


close this sectionLocation

Organism
StrainS699
Entry nameRifamycin
Contig
Start / Stop / Direction16,510 / 17,700 / + [in whole cluster]
16,510 / 17,700 / + [in contig]
Location16510..17700 [in whole cluster]
16510..17700 [in contig]
TypeCDS
Length1,191 bp (396 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative cytochrome P450
Product (GenBank)putative cytochrome P450-like protein
Gene
Gene (GenBank)
EC number
Keyword
  • hydroxylate
Note
Note (GenBank)
  • ORF0
Reference
ACC
PmId
[9512878] Biosynthesis of the ansamycin antibiotic rifamycin: deductions from the molecular analysis of the rif biosynthetic gene cluster of Amycolatopsis mediterranei S699. (Chem Biol. , 1998)
Related Reference
ACC
A6YRR3
PmId
[19376895] Characterization of P450 FcpC, the enzyme responsible for bioconversion of diosgenone to isonuatigenone in Streptomyces virginiae IBL-14. (Appl Environ Microbiol. , 2009)

close this sectionSequence

selected fasta
>putative cytochrome P450 [putative cytochrome P450-like protein]
MTDAISFEVPWDRTDKFDPPAVFDSLREERPLAKMVYPDGHVGWIVSSYELVREVLSDLR
FSHSCEVGHFPVTHQGQVIPTHPLIPGMFIHMDPPEHTRYRKLLTGEFTVRRASRLIPRA
EAVAAEQIEVMRAKGAPADVVMDFAKPLVLRMLGELVGLPYEERDRYVPAVTLLHDAEAD
PAEAAAAYEVAGKFFDEVIERRRQRPQDDLISSLVTEDLTQEELRNIVTLLLFAGYETTE
GALATGVFALLHHTDQLAALRAEPEKLDAAIEELLRYLTVNQYHTYRTALEDVKLEGELI
KKGDTVTVSLPAANRDPAKFGCPAELDIERDTSGHVAFGFGIHQCLGQNLARIELRAGFT
ALLRAFPELRLAVPADEVPLRLKGSVFSVKKLPVSW
selected fasta
>putative cytochrome P450 [putative cytochrome P450-like protein]
ATGACCGACGCAATATCCTTCGAGGTGCCGTGGGACCGGACCGACAAGTTCGACCCGCCC
GCGGTGTTCGACTCTCTGCGCGAAGAACGTCCGCTCGCGAAGATGGTTTACCCGGATGGG
CACGTCGGCTGGATCGTTTCCAGCTACGAGCTGGTCCGCGAGGTCCTCAGCGACCTGCGG
TTCAGCCACAGCTGCGAAGTCGGCCACTTCCCGGTGACCCACCAGGGCCAGGTCATCCCG
ACCCACCCGCTGATCCCCGGCATGTTCATCCACATGGACCCGCCCGAGCACACGCGCTAC
CGCAAGCTGCTGACCGGCGAGTTCACCGTCCGCCGCGCCAGCAGGCTGATCCCGCGGGCC
GAGGCCGTGGCCGCCGAGCAGATCGAGGTCATGCGGGCCAAGGGCGCCCCCGCGGACGTG
GTCATGGACTTCGCCAAGCCGCTGGTGCTGCGGATGCTGGGCGAGCTCGTCGGCCTGCCC
TACGAGGAACGCGACCGGTACGTGCCCGCGGTGACCCTCCTGCACGACGCCGAAGCGGAC
CCGGCCGAGGCCGCGGCCGCCTACGAGGTGGCCGGGAAGTTCTTCGACGAGGTCATCGAG
CGCCGCCGGCAGCGGCCCCAGGACGACCTCATCAGCTCGCTCGTCACCGAGGACCTGACC
CAGGAGGAGCTGCGCAACATCGTCACCCTGCTGCTGTTCGCCGGGTACGAGACCACCGAG
GGCGCGCTCGCCACCGGCGTCTTCGCGCTGCTGCACCACACCGATCAGCTGGCGGCACTG
CGCGCGGAGCCGGAAAAGCTCGACGCCGCGATCGAAGAGCTGCTGCGCTACCTGACCGTC
AACCAGTACCACACCTACCGCACCGCGCTGGAGGACGTGAAGCTGGAGGGCGAGCTGATC
AAGAAGGGCGACACGGTGACGGTGTCGCTGCCCGCGGCCAACCGCGACCCGGCCAAGTTC
GGCTGTCCCGCGGAGCTCGACATCGAGCGGGACACCTCCGGCCACGTCGCGTTCGGCTTC
GGCATCCACCAGTGCCTGGGCCAGAACCTGGCGCGCATCGAGCTGCGGGCCGGCTTCACG
GCGCTCCTGCGGGCGTTCCCCGAGCTCCGGCTGGCCGTCCCGGCCGACGAGGTTCCGCTG
CGGCTGAAGGGTTCCGTCTTCTCGGTGAAGAAGCTGCCCGTCTCCTGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [234-251]  1.1e-08 PR00385 [269-280]  1.1e-08 PR00385 [336-345]  1.1e-08 PR00385 [345-356]  1.1e-08 PR00385
PR00385   P450
 [11-396]  8.7e-101 G3DSA:1.10.630.10
G3DSA:1.10.630.10   no description
 [189-392]  2e-27 PF00067
PF00067   p450
 [17-396]  1.5e-93 SSF48264
SSF48264   Cytochrome P450
IPR002397 Cytochrome P450, B-class (Family)
 [92-103]  1.8e-52 PR00359 [139-155]  1.8e-52 PR00359 [156-171]  1.8e-52 PR00359 [193-215]  1.8e-52 PR00359 [269-280]  1.8e-52 PR00359 [287-314]  1.8e-52 PR00359 [315-330]  1.8e-52 PR00359 [336-345]  1.8e-52 PR00359 [345-356]  1.8e-52 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [338-347]  PS00086
PS00086   CYTOCHROME_P450
SignalP No significant hit
TMHMM No significant hit