close all open/close all

CDS information : Rifam_00210


close this sectionLocation

Organism
StrainS699
Entry nameRifamycin
Contig
Start / Stop / Direction17,741 / 31,948 / + [in whole cluster]
17,741 / 31,948 / + [in contig]
Location17741..31948 [in whole cluster]
17741..31948 [in contig]
TypeCDS
Length14,208 bp (4,735 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)RifA
Gene
Gene (GenBank)rifA
EC number
Keyword
Note
Note (GenBank)
  • rifamycin polyketide synthase
Reference
ACC
PmId
[9512878] Biosynthesis of the ansamycin antibiotic rifamycin: deductions from the molecular analysis of the rif biosynthetic gene cluster of Amycolatopsis mediterranei S699. (Chem Biol. , 1998)
[10430893] Direct evidence that the rifamycin polyketide synthase assembles polyketide chains processively. (Proc Natl Acad Sci U S A. , 1999)
[11352749] The loading module of rifamycin synthetase is an adenylation-thiolation didomain with substrate tolerance for substituted benzoates. (Biochemistry. , 2001)
[11955082] The loading and initial elongation modules of rifamycin synthetase collaborate to produce mixed aryl ketide products. (Biochemistry. , 2002)
[27246853] Protein-Protein Interactions, Not Substrate Recognition, Dominate the Turnover of Chimeric Assembly Line Polyketide Synthases. (J Biol Chem. , 2016)

close this sectionPKS/NRPS Module

0
1 methylmalonyl-CoA
2 malonyl-CoA
3 methylmalonyl-CoA
A34..436
PCP541..611
KS632..1004
AT1144..1453
dh1489..1634
KR1829..2005
ACP2104..2174
KS2195..2568
AT2717..3025
ACP3077..3151
KS3171..3546
AT3694..4008
kr4307..4475
ACP4580..4650

close this sectionSequence

selected fasta
>polyketide synthase [RifA]
MRTDLIKPLHVALLENATRFAGKPAFADDHRTVTYGDLEARTRRLAGHLAGLGVRHGDRV
AICLGNRVSTVESYFAILRAGAVGVPLNPGSATAELEHPLTDSGATVVVTDAAQAARLRL
APHVELLVTGDDVPEGAHSYDELALSEPAEPAADDLELDEPAWMFYTSGTTGRPKGVVST
QRNCLWSVASCYVPFPGLSDQDRVLWPLPLFHSLSHIACVLSATVVGASVRIADGSSADD
VMRLIEAESSTFLAGVPTTYHHLVRAARQRGFSAPSLRIGLAGGAVLGAGLRSEFEETFG
VPLIDAYGSTETCGAITMNPPDGARVEGSCGLAVPGVDVRVVDPDTGLDVPAGEEGEVWV
SGPNVMLGYHNSPEATAAAMRDGWFRTGDLARRDDAGYFTICGRIKELIIRGGANIHPGE
VEAVLRTVDGVADAAVGGVPHDTLGEVPVAYVIPGPTGFDPAALIEKCREQLSAYKVPDR
ILEVAHIPRTASGKIRRGLLTDEPAQLRYAATEHEEQSRHADESVAAALRARLSGLDERA
QCELLEDLVRTQAADVLGQPVPDGRAFRDLGFTSLAIVELRNRLTEHTGLWLPASAVFDH
PTPAALAARVRAELLGITQAVAEPVVAADPGEPIAIVGMACRLPGGVASPEDLWRLVAER
VDAVSEFPGDRGWDLDSLIDPDRERAGTSYVGQGGFLHDAGEFDAGFFGISPREAVAMDP
QQRLLLETSWEALENAGVDPIALKGTDTGVFSGLMGQGYGSGAVAPELEGFVTTGVASSV
ASGRVSYVLGLEGPAVTVDTACSSSLVAMHLAAQALRQGECSMALAGGVTVMATPGSFVE
FSRQRALAPDGRCKAFAAAADGTGWSEGVGVVVLERLSVARERGHRILAVLRGSAVNQDG
ASNGLTAPNGLSQQRVIRRALAAAGLAPSDVDVVEAHGTGTTLGDPIEAQALLATYGQER
KQPLWLGSLKSNIGHAQAAAGVAGVIKMVQALRHETLPPTLHVDKPTLEVDWSAGAIELL
TEARAWPRNGRPRRAGVSSFGVSGTNAHLILEEAPAEEPVAAPELPVVPLVVSARSTESL
SGQAERLASLLEGDVSLTEVAGALVSRRAVLDERAVVVAGSREEAVTGLRALNTAGSGTP
GKVVWVFPGQGTQWAGMGRELLAESPVFAERIAECAAALAPWIDWSLVDVLRGEGDLGRV
DVLQPACFAVMVGLAAVWESVGVRPDAVVGHSQGEIAAACVSGALSLEDAAKVVALRSQA
IAAELSGRGGMASVALGEDDVVSRLVDGVEVAAVNGPSSVVIAGDAHALDATLEILSGEG
IRVRRVAVDYASHTRHVEDIRDTLAETLAGISAQAPAVPFYSTVTSEWVRDAGVLDGGYW
YRNLRNQVRFGAAATALLEQGHTVFVEVSAHPVTVQPLSELTGDAIGTLRREDGGLRRLL
ASMGELFVRGIDVDWTAMVPAAGWVDLPTYAFEHRHYWLEPAEPASAGDPLLGTVVSTPG
SDRLTAVAQWSRRAQPWAVDGLVPNAALVEAAIRLGDLAGTPVVGELVVDAPVVLPRRGS
REVQLIVGEPGEQRRRPIEVFSREADEPWTRHAHGTLAPAAAAVPEPAAAGDATDVTVAG
LRDADRYGIHPALLDAAVRTVVGDDLLPSVWTGVSLLASGATAVTVTPTATGLRLTDPAG
QPVLTVESVRGTPFVAEQGTTDALFRVDWPEIPLPTAETADFLPYEATSAEATLSALQAW
LADPAETRLAVVTGDCTEPGAAAIWGLVRSAQSEHPGRIVLADLDDPAVLPAVVASGEPQ
VRVRNGVASVPRLTRVTPRQDARPLDPEGTVLITGGTGTLGALTARHLVTAHGVRHLVLV
SRRGEAPELQEELTALGASVAIAACDVADRAQLEAVLRAIPAEHPLTAVIHTAGVLDDGV
VTELTPDRLATVRRPKVDAARLLDELTREADLAAFVLFSSAAGVLGNPGQAGYAAANAEL
DALARQRNSLDLPAVSIAWGYWATVSGMTEHLGDADLRRNQRIGMSGLPADEGMALLDAA
IATGGTLVAAKFDVAALRATAKAGGPVPPLLRGLAPLPRRAAAKTASLTERLAGLAETEQ
AAALLDLVRRHAAEVLGHSGAESVHSGRTFKDAGFDSLTAVELRNRLAAATGLTLSPAMI
FDYPKPPALADHLRAKLFGSAANRPAEIGTAAAEEPIAIVAMACRFPGGVHSPEDLWRLV
ADGADAVTEFPADRGWDTDRLYHEDPDHEGTTYVRHGAFLDDAAGFDAAFFGISPNEALA
MDPQQRLLLETSWELFERAAIDPTTLAGQDIGVFAGVNSHDYSMRMHRAAGVEGFRLTGG
SASVLSGRVAYHFGVEGPAVTVDTACSSSLVALHMAVQALQRGECSMALAGGVMVMGTVE
TFVEFSRQRGLAPDGRCKAFADGADGTGWSEGVGLLLVERLSEAQRRGHQVLAVVRGSAV
NSDGASNGLTAPNGPSQQRVIRKALAAAGLSTSDVDAVEAHGTGTTLGDPIEAEALLATY
GQNRETPLWLGSVKSNLGHTQAAAGVAGVIKMVMAMRHGVLPRTLHVDRPSSYVDWSAGA
VELLTEARDWVSNGHPRRAGVSSFGIGGTNAHVVLEEVAAPITTPQPEPAEFLVPVLVSA
RTAAGLRGQAGRLAAFLGDRTDVRVPDAAYALATTRAQLDHRAVVLASDRAQLCADLAAF
GSGVVTGTPVDGKLAVLFTGQGSQWAGMGRELAETFPVFRDAFEAACEAVDTHLRERPLR
EVVFDDSALLDQTMYTQGALFAVETALFRLFESWGVRPGLLAGHSIGELAAAHVSGVLDL
ADAGELVAARGRLMQALPAGGAMVAVQATEDEVAPLLDGTVCVAAVNGPDSVVLSGTEAA
VLAVADELAGRGRKTRRLAVSHAFHSPLMEPMLDDFRAVAERLTYRAGSLPVVSTLTGEL
AALDSPDYWVGQVRNAVRFSDAVTALGAQGASTFLELGPGGALAAMALGTLGGPEQSCVA
TLRKNGAEVPDVLTALAELHVRGVGVDWTTVLDEPATAVGTVLPTYAFQHQRFWVDVDET
AAVSVTPPPAEPIVDRPVQDVLELVRESAAVVLGHRDAGSFDLDRSFKDHGFDSLSAVKL
RNRLRDFTGVELPSTLIFDYPNPAVLADHLRAELLGERPAAPAPVTRDVSDEPIAIVGMS
TRLPGGADSPEELWKLVAEGRDAVSGFPVDRGWDLDGLYHPDPAHAGTSYTRSGGFLHDA
AQFDAGLFGISPREALAMDPQQRLLLETSWEALERAGVDPLSARGSDVGVFTGIVHHDYV
TRLREVPEDVQGYTMTGTASSVASGRVAYVFGFEGPAVTVDTACSSSLVAMHLAAQALRQ
GECSMALAGGATVMASPDAFLEFSRQRGLSADGRCKAYAEGADGTGWAEGVGVVVLERLS
VARERGHRVLAVLRGSAVNQDGASNGLTAPNGPSQQRVIRGALASAGLAPSDVDVVEGHG
TGTALGDPIEVQALLATYGQEREQPLWLGSLKSNLGHTQAAAGVVGVIKMIMAMRHGVMP
ATLHVDERTSQVDWSAGAIEVLTEAREWPRTGRPRRAGVSSFGASGTNAHLIIEEGPAEE
AVDEEVASVVPLVVSARSAGSLAGQAGRLAAVLENESLAGVAGALVSGRATLNERAVVIA
GSRDEAQDGLQALARGENAPGVVTGTAGKPGKVVWVFPGQGSQWMGMGRDLLDSSPVFAA
RIKECAAALEQWTDWSLLDVLRGDADLLDRVDVVQPASFAMMVGLAAVWTSLGVTPDAVL
GHSQGEIAAACVSGALSLDDAAKVVALRSQAIAGELAGRGGMASVALSEEDAVARLTPWA
NRVEVAAVNSPSSVVIAGDAQALDEALEALAGDGVRVRRVAVDYASHTRHVEAIAETLAK
TLAGIDARVPAIPFYSTVLGTWIEQAVVDAGYWYRNLRQQVRFGPSVADLAGLGHTVFVE
ISAHPVLVQPLSEISDDAVVTGSLRRDDGGLRRLLASAAELYVRGVAVDWTAAVPAAGWV
DLPTYAFDRRHFWLHEAETAEAAEGMDGEFWTAIEQSDVDSLAELLELVPEQRGALSTVV
PVLAQWRDRRRERSTAEKLRYQVTWQPLEREAAGVPGGRWLAVVPAGTTDALLKELTGQG
LDIVRLEIEEASRAQLAEQLRNVLAEHDLTGVLSLLALDGGPADAAEITASTLALVQALG
DTTTSAPLWCLTSGAVNIGIQDAVTAPAQAAVWGLGRAVALERLDRWGGLVDLPAAIDAR
TAQALLGVLNGAAGEDQLAVRRSGVYRRRLVRKPVPESATSRWEPRGTVLVTGGAEGLGR
HASVWLAQSGAERLIVTGTDGVDELTAELAEFGTTVEFCADTDRDAIAQLVADSEVTAVV
HAADIAQTSSVDDTGVADLDEVFAAKVTTAVWLDQLFEDTPLDAFVVFSSIAGIWGGGGQ
GPAGAANAVLDALVEWRRARGLKATSIAWGALDQIGIGMDEAALAQLRRRGVIPMAPPLA
VTAMVQAVAGNEKAVAVADMDWAAFIPAFTSVRPSPLFADLPEAKAILRAAQDDGEDGDT
ASSLADSLRAVPDAEQNRILLKLVRGHASTVLGHSGAEGIGPRQAFQEVGFDSLAAVNLR
NSLHAATGLRLPATLIFDYPTPEALVGYLRVELLREADDGLDGREDDLRRVLAAVPFARF
KEAGVLDTLLGLADTGTEPGTDAETTEAAPAADDAELIDALDISGLVQRALGQTS
selected fasta
>polyketide synthase [RifA]
GTGCGCACCGATCTCATCAAGCCACTTCACGTCGCACTCCTGGAGAACGCGACCCGCTTC
GCCGGCAAGCCGGCCTTCGCCGACGACCACCGGACGGTCACCTACGGCGACCTCGAGGCG
CGGACGCGCCGGCTGGCCGGGCACCTGGCCGGCCTCGGTGTCCGGCACGGCGACCGGGTG
GCGATCTGCCTCGGCAACCGGGTGTCCACTGTGGAGAGTTACTTCGCGATCCTGCGCGCG
GGTGCCGTCGGCGTGCCGCTCAACCCCGGTTCGGCGACGGCCGAGCTCGAGCACCCGCTG
ACCGACAGCGGCGCCACGGTGGTCGTCACCGACGCCGCCCAGGCGGCCCGGCTCCGGCTC
GCGCCGCACGTCGAGCTGCTGGTGACCGGCGACGACGTCCCGGAGGGCGCCCACTCCTAC
GACGAACTCGCCCTCAGCGAACCGGCCGAGCCCGCCGCGGACGACCTCGAGCTCGACGAG
CCGGCGTGGATGTTCTACACGTCGGGCACGACCGGGCGGCCCAAGGGCGTCGTGTCCACG
CAGCGCAACTGCCTCTGGTCCGTCGCTTCCTGCTACGTGCCGTTCCCCGGGTTGTCGGAC
CAGGACCGGGTGCTCTGGCCGCTCCCGCTGTTCCACAGCCTTTCGCACATCGCCTGCGTC
CTGTCCGCCACCGTGGTCGGGGCCAGCGTCCGGATCGCCGACGGCAGCTCCGCCGACGAC
GTGATGCGGCTGATCGAGGCGGAGAGCTCGACCTTCCTGGCCGGCGTGCCGACCACCTAC
CACCACCTGGTGCGGGCCGCCCGGCAGCGCGGTTTCTCCGCGCCGAGCCTGCGGATCGGC
CTGGCCGGGGGCGCGGTCCTCGGCGCCGGGCTGCGAAGCGAGTTCGAAGAGACCTTCGGG
GTCCCGCTGATCGACGCCTACGGCAGCACCGAGACCTGCGGGGCGATCACCATGAACCCG
CCGGACGGCGCCCGCGTCGAGGGCTCGTGCGGCTTGGCCGTGCCGGGCGTCGACGTGCGG
GTCGTCGACCCCGACACCGGGCTCGACGTCCCCGCCGGCGAGGAGGGCGAGGTCTGGGTC
AGCGGGCCGAACGTCATGCTCGGCTACCACAACAGCCCGGAGGCGACCGCCGCGGCGATG
CGGGACGGCTGGTTCCGGACCGGGGACCTGGCCCGCCGCGACGACGCCGGTTACTTCACC
ATCTGCGGCCGGATCAAGGAACTCATCATCCGCGGCGGCGCGAACATCCACCCCGGCGAG
GTCGAGGCGGTCCTGCGCACGGTCGACGGCGTCGCGGACGCGGCGGTCGGCGGTGTGCCG
CACGACACGCTCGGCGAGGTGCCGGTCGCCTACGTCATCCCCGGACCGACCGGTTTCGAT
CCTGCGGCGTTGATCGAGAAGTGCCGCGAACAGCTGTCCGCCTACAAGGTGCCGGACCGG
ATCCTCGAGGTCGCCCACATTCCCCGGACCGCGTCGGGCAAGATCCGGCGCGGGCTGCTG
ACCGACGAGCCCGCGCAGCTGCGGTACGCCGCGACCGAACACGAGGAACAGTCCCGGCAC
GCCGACGAGTCCGTCGCGGCGGCGCTGCGCGCGCGACTGTCCGGTTTGGACGAACGCGCC
CAGTGCGAGCTCCTGGAAGACCTCGTCCGCACCCAGGCGGCCGACGTGCTGGGGCAGCCG
GTCCCGGACGGGCGTGCGTTCCGCGACCTCGGCTTCACGTCGCTGGCCATCGTGGAGCTG
CGCAACCGGCTGACCGAGCACACCGGGCTCTGGCTGCCCGCCAGCGCCGTCTTCGACCAC
CCCACGCCGGCGGCGCTGGCCGCCCGCGTCCGGGCTGAGCTCCTCGGGATCACGCAGGCC
GTCGCGGAGCCGGTCGTCGCGGCCGACCCGGGCGAGCCGATCGCGATCGTGGGGATGGCC
TGCCGCCTGCCGGGTGGCGTGGCGTCCCCGGAAGACCTGTGGCGGCTGGTGGCCGAGCGC
GTCGACGCCGTTTCGGAGTTCCCCGGCGACCGCGGCTGGGACCTGGACAGCCTGATCGAC
CCGGACCGGGAGCGCGCCGGGACGTCGTACGTCGGCCAGGGCGGATTCCTGCACGACGCC
GGCGAGTTCGACGCCGGGTTCTTCGGGATCTCGCCGCGTGAGGCCGTCGCGATGGACCCG
CAGCAGCGGTTGCTGCTGGAGACGTCGTGGGAGGCCCTCGAAAACGCCGGAGTCGACCCG
ATCGCGTTGAAGGGCACCGACACCGGCGTGTTCTCCGGCCTCATGGGCCAGGGGTACGGG
TCCGGCGCGGTGGCGCCGGAGCTCGAAGGTTTCGTCACCACCGGGGTCGCGTCGAGCGTG
GCCTCGGGCCGGGTGTCGTACGTGCTGGGACTGGAAGGCCCGGCGGTCACCGTGGACACC
GCGTGTTCGTCGTCGCTGGTCGCGATGCACCTGGCCGCGCAGGCCCTGCGGCAGGGCGAA
TGCTCGATGGCGCTCGCCGGCGGGGTCACGGTGATGGCCACGCCGGGCTCGTTCGTCGAG
TTCTCCCGCCAGCGGGCCCTGGCGCCCGACGGGCGCTGCAAGGCCTTCGCGGCGGCGGCC
GACGGGACCGGCTGGTCCGAGGGTGTCGGCGTGGTCGTCCTCGAGCGGCTGTCCGTGGCG
CGCGAGCGGGGCCACCGGATCCTGGCCGTTTTGCGTGGCAGCGCGGTCAACCAGGACGGC
GCGTCCAACGGGCTCACCGCGCCGAACGGCCTCTCGCAGCAGCGGGTCATCCGCCGCGCG
CTGGCCGCGGCCGGGCTGGCACCGTCCGATGTGGACGTCGTCGAGGCGCACGGCACCGGG
ACCACGCTGGGTGACCCGATCGAGGCGCAGGCCCTGCTGGCGACCTACGGCCAGGAGCGG
AAGCAGCCGTTGTGGCTCGGTTCGCTCAAGTCGAACATCGGCCACGCGCAGGCGGCCGCG
GGCGTTGCGGGCGTCATCAAGATGGTGCAGGCGCTGCGGCACGAGACCTTGCCGCCGACG
CTGCATGTCGACAAGCCGACTCTTGAGGTGGACTGGTCCGCCGGTGCCATTGAACTGCTG
ACGGAGGCCCGTGCGTGGCCGCGCAACGGCCGTCCGCGCCGGGCCGGGGTGTCGTCGTTC
GGCGTCAGCGGGACCAACGCGCACCTGATCCTGGAGGAGGCGCCGGCCGAGGAGCCGGTC
GCTGCCCCGGAACTGCCGGTGGTGCCCCTGGTGGTGTCGGCGCGGAGCACGGAGTCGCTG
TCCGGGCAGGCCGAGCGGCTGGCGTCCCTCCTCGAAGGGGACGTCTCGCTGACCGAGGTG
GCCGGGGCGCTGGTGTCCCGCCGGGCGGTGCTGGACGAGCGGGCCGTCGTCGTGGCCGGT
TCGCGCGAGGAAGCCGTGACCGGGCTGCGGGCGCTGAACACGGCCGGTTCGGGGACGCCG
GGCAAGGTCGTGTGGGTGTTCCCGGGGCAGGGGACGCAGTGGGCCGGGATGGGCCGTGAG
CTGCTGGCCGAGTCCCCGGTGTTCGCCGAGCGGATCGCCGAGTGCGCGGCCGCGTTGGCG
CCGTGGATCGACTGGTCGCTCGTCGACGTCCTGCGCGGCGAGGGCGACCTGGGTCGGGTC
GATGTGCTGCAGCCGGCCTGTTTCGCGGTGATGGTCGGGCTGGCTGCCGTCTGGGAGTCC
GTGGGGGTCCGGCCGGACGCCGTCGTCGGGCACTCGCAGGGTGAGATCGCGGCTGCCTGC
GTTTCGGGGGCGTTGTCCCTCGAGGACGCGGCGAAGGTGGTGGCCCTGCGCAGCCAGGCC
ATCGCGGCGGAACTGTCCGGCCGCGGCGGGATGGCGTCGGTCGCCCTGGGCGAGGACGAC
GTCGTTTCGCGGCTGGTGGACGGGGTCGAGGTCGCCGCCGTCAACGGCCCGTCGTCGGTG
GTGATCGCCGGGGATGCCCATGCCCTCGACGCGACCCTGGAAATCTTGTCCGGGGAAGGC
ATCCGGGTTCGGCGGGTGGCGGTGGACTACGCCTCGCACACCCGGCATGTCGAGGACATC
CGCGACACTCTTGCCGAAACCTTGGCCGGGATCAGTGCGCAGGCGCCGGCTGTGCCGTTC
TACTCCACCGTCACGAGCGAGTGGGTGCGCGACGCGGGGGTGCTGGACGGCGGCTACTGG
TACCGGAACCTGCGCAACCAGGTCCGGTTCGGAGCGGCCGCGACGGCCCTGCTCGAGCAG
GGCCACACGGTGTTCGTCGAGGTCAGTGCGCACCCGGTGACGGTCCAGCCCTTGAGCGAG
CTCACCGGGGACGCGATCGGGACATTGCGGCGTGAAGACGGTGGCCTGCGGCGGTTGCTG
GCTTCGATGGGTGAGCTGTTCGTCCGCGGCATCGACGTGGACTGGACGGCGATGGTGCCC
GCGGCCGGCTGGGTCGACTTGCCGACCTACGCGTTCGAACACCGGCACTACTGGCTCGAG
CCCGCCGAGCCCGCTTCGGCCGGAGACCCGCTGCTGGGCACAGTCGTCAGCACTCCCGGT
TCGGACCGACTCACCGCCGTGGCGCAGTGGTCGCGCCGGGCGCAGCCCTGGGCGGTGGAC
GGCCTGGTGCCGAACGCGGCCCTGGTCGAGGCGGCCATCCGGCTCGGCGACCTGGCCGGC
ACCCCCGTCGTCGGCGAACTGGTCGTCGACGCGCCGGTGGTGCTGCCGCGGCGCGGCAGC
CGCGAGGTCCAGCTGATCGTCGGCGAGCCCGGCGAGCAGCGGCGGCGTCCGATCGAGGTC
TTTTCCCGGGAAGCCGACGAGCCGTGGACGCGGCACGCGCACGGCACACTCGCTCCCGCC
GCCGCTGCGGTGCCAGAACCGGCGGCGGCGGGAGACGCCACCGACGTCACCGTGGCCGGC
CTGCGCGACGCGGACCGGTACGGGATCCACCCCGCGCTGCTGGACGCCGCCGTCCGCACG
GTCGTCGGCGACGACCTGCTCCCGTCGGTGTGGACCGGCGTGTCCCTGCTGGCCTCCGGG
GCCACGGCCGTGACCGTGACGCCGACGGCGACCGGCCTGCGGCTGACCGACCCGGCCGGG
CAGCCCGTCCTGACCGTCGAATCCGTGCGCGGCACGCCGTTCGTCGCCGAGCAGGGGACC
ACCGACGCGCTCTTCCGCGTCGACTGGCCGGAAATCCCGCTGCCCACCGCCGAAACCGCG
GACTTCCTGCCGTACGAAGCCACGTCGGCCGAGGCGACCCTCTCCGCGCTCCAGGCCTGG
CTGGCAGACCCCGCGGAAACCCGGCTGGCCGTGGTCACCGGGGACTGCACCGAACCCGGC
GCGGCCGCGATCTGGGGCCTGGTGCGCTCGGCGCAGTCCGAACACCCCGGCCGGATCGTG
CTGGCCGACCTCGACGACCCCGCCGTGCTGCCCGCCGTGGTGGCGAGCGGCGAACCGCAG
GTGCGGGTGCGCAACGGCGTCGCCTCGGTGCCGCGCTTGACCCGGGTTACTCCCCGGCAG
GACGCGCGGCCGCTCGACCCCGAGGGCACCGTCCTGATCACCGGCGGCACCGGCACGCTC
GGTGCGCTGACCGCCCGGCACCTCGTCACCGCGCACGGCGTCCGGCACCTGGTGCTGGTC
AGCCGCCGCGGTGAGGCTCCCGAGCTGCAGGAAGAACTGACCGCACTGGGGGCATCCGTC
GCCATCGCCGCCTGCGACGTGGCAGACCGGGCGCAGCTCGAAGCCGTCTTGCGCGCGATC
CCGGCCGAGCACCCGCTCACCGCCGTGATCCACACCGCGGGGGTCCTCGACGACGGCGTC
GTCACCGAGCTGACCCCGGACCGGCTCGCCACCGTGCGGCGGCCGAAGGTCGACGCCGCC
CGGCTCCTGGACGAGCTCACCCGGGAGGCCGATCTCGCCGCGTTCGTGCTGTTCTCCTCG
GCGGCGGGTGTGCTGGGCAACCCCGGCCAGGCCGGGTACGCCGCCGCCAACGCCGAGCTG
GATGCGTTGGCGCGCCAGCGGAACAGCCTCGACCTGCCCGCGGTGTCCATCGCATGGGGC
TACTGGGCGACGGTCAGCGGGATGACCGAGCACCTGGGCGACGCCGACCTGCGGCGCAAC
CAGCGGATCGGCATGTCCGGGCTTCCCGCCGACGAGGGCATGGCGCTGCTGGACGCCGCC
ATCGCCACCGGTGGCACGCTGGTCGCGGCCAAGTTCGACGTCGCCGCGCTGCGGGCGACG
GCGAAGGCCGGCGGCCCGGTGCCGCCGCTGCTGCGTGGCCTGGCCCCGCTGCCGCGCCGG
GCGGCGGCCAAGACCGCGTCGCTGACCGAACGCCTCGCCGGGCTGGCCGAGACCGAGCAG
GCCGCGGCCCTGCTCGACCTGGTCCGGCGGCACGCCGCCGAGGTGCTCGGGCACAGCGGC
GCCGAATCCGTCCATTCAGGACGGACGTTCAAGGACGCCGGCTTCGACTCGCTGACCGCG
GTGGAACTGCGGAACCGCCTCGCGGCCGCGACCGGGCTCACCCTGTCCCCGGCGATGATC
TTCGACTACCCGAAGCCCCCGGCGCTCGCGGACCACCTGCGCGCCAAGCTCTTCGGATCG
GCGGCGAACCGGCCGGCCGAGATCGGCACCGCCGCGGCCGAGGAGCCGATCGCGATCGTC
GCGATGGCGTGCCGCTTCCCCGGTGGCGTGCACAGCCCCGAGGACCTGTGGCGGCTGGTC
GCCGACGGCGCCGACGCCGTCACCGAGTTCCCCGCCGACCGCGGCTGGGACACCGACCGG
CTCTACCACGAAGACCCCGACCACGAAGGCACGACGTACGTCCGGCACGGCGCCTTCCTC
GACGACGCCGCCGGGTTCGACGCCGCCTTCTTCGGCATCTCGCCGAACGAGGCGCTCGCC
ATGGACCCGCAGCAGCGGCTGCTGCTGGAGACGTCCTGGGAGCTGTTCGAGCGGGCCGCG
ATCGACCCGACCACGCTGGCCGGCCAGGACATCGGCGTCTTCGCCGGCGTCAACAGCCAC
GACTACAGCATGCGGATGCACCGGGCCGCCGGTGTCGAGGGCTTCCGGCTCACCGGCGGT
TCGGCCAGCGTGCTCTCCGGCCGCGTCGCCTACCACTTCGGCGTCGAAGGCCCGGCCGTC
ACGGTCGACACGGCCTGCTCGTCTTCGCTGGTCGCGCTGCACATGGCGGTGCAGGCCCTG
CAGCGCGGCGAGTGCTCCATGGCGCTCGCGGGCGGCGTGATGGTGATGGGCACGGTCGAG
ACGTTCGTCGAGTTCTCGCGGCAGCGCGGGCTGGCCCCCGACGGCCGCTGCAAGGCGTTC
GCCGACGGCGCGGACGGCACCGGCTGGTCCGAGGGCGTCGGGCTGCTCCTGGTGGAGCGG
CTGTCCGAGGCTCAGCGTCGCGGGCACCAGGTCCTCGCCGTGGTCCGCGGGTCGGCGGTC
AACTCCGACGGCGCGTCGAACGGCTTGACGGCCCCGAACGGCCCGTCCCAGCAGCGCGTG
ATCCGCAAGGCACTGGCCGCCGCCGGACTGTCCACATCGGACGTCGACGCGGTGGAGGCG
CACGGCACCGGGACGACCCTGGGCGACCCGATCGAGGCCGAGGCGCTGCTGGCCACCTAC
GGCCAGAACCGGGAAACGCCGCTGTGGCTCGGGTCGGTGAAGTCGAACCTCGGGCACACG
CAGGCGGCTGCGGGTGTCGCAGGCGTGATCAAGATGGTCATGGCCATGCGCCACGGCGTC
CTGCCCCGGACGCTGCACGTCGACCGGCCGTCGTCCTATGTGGACTGGTCGGCCGGTGCG
GTCGAGCTGCTGACCGAGGCACGGGACTGGGTGAGCAACGGCCACCCGCGCCGCGCGGGC
GTGTCGTCGTTCGGCATCGGCGGCACCAACGCGCACGTCGTCCTCGAAGAGGTTGCCGCA
CCGATCACCACGCCGCAGCCTGAGCCGGCCGAGTTCCTGGTGCCGGTGCTCGTCTCCGCG
CGGACGGCGGCGGGTCTGCGCGGCCAGGCCGGACGGCTCGCCGCGTTCCTCGGCGACCGG
ACCGACGTCCGCGTCCCCGATGCCGCCTACGCACTGGCCACCACGCGCGCCCAGCTCGAC
CACCGGGCCGTCGTCCTGGCCTCCGACCGGGCACAGCTCTGCGCGGACCTTGCCGCGTTC
GGCTCCGGCGTCGTGACCGGAACGCCGGTTGACGGCAAGCTGGCCGTGCTCTTCACCGGC
CAGGGCAGCCAGTGGGCCGGGATGGGCCGTGAACTCGCCGAGACGTTCCCGGTCTTCCGC
GACGCCTTCGAGGCCGCGTGCGAGGCCGTGGACACGCACCTGCGTGAGCGTCCGCTGCGC
GAGGTCGTGTTCGACGACAGCGCGCTGCTCGACCAGACGATGTACACCCAGGGCGCCCTG
TTCGCCGTGGAGACCGCGTTGTTCCGGCTCTTCGAGTCCTGGGGTGTGCGGCCGGGTCTC
CTCGCCGGTCACTCGATCGGCGAGCTCGCCGCCGCGCACGTGTCCGGCGTGCTGGACCTG
GCCGACGCGGGCGAGCTGGTCGCCGCGCGCGGCCGGCTGATGCAGGCCCTGCCCGCGGGC
GGCGCGATGGTCGCCGTCCAGGCGACCGAGGACGAAGTCGCGCCCCTGCTCGACGGCACG
GTCTGCGTCGCCGCGGTCAACGGTCCGGACTCGGTGGTGCTCTCCGGCACCGAAGCCGCC
GTGCTCGCCGTCGCGGATGAACTGGCTGGTCGCGGCCGTAAGACCCGACGGCTGGCCGTG
AGCCACGCCTTCCACTCGCCGCTCATGGAACCGATGCTCGACGACTTCCGCGCGGTCGCC
GAACGCCTGACGTACCGGGCCGGTTCGCTGCCCGTCGTCTCGACGCTGACCGGGGAACTC
GCGGCGCTCGACAGCCCGGACTACTGGGTCGGCCAGGTGCGCAACGCCGTGCGGTTCAGC
GACGCCGTCACCGCGCTGGGCGCCCAAGGCGCGTCGACGTTCCTCGAGCTCGGCCCGGGC
GGTGCGCTCGCCGCGATGGCGCTCGGCACGCTCGGCGGACCCGAGCAGAGCTGCGTCGCG
ACCCTGCGCAAGAACGGCGCCGAGGTGCCCGACGTCCTCACCGCGCTCGCCGAACTGCAC
GTCCGGGGCGTGGGCGTCGACTGGACGACCGTGCTCGACGAACCGGCCACGGCGGTCGGG
ACCGTCCTGCCCACCTACGCGTTCCAGCACCAGCGCTTCTGGGTCGACGTCGACGAAACA
GCGGCCGTCAGCGTCACCCCGCCGCCGGCGGAGCCGATCGTGGACCGGCCGGTGCAGGAC
GTGCTGGAGCTGGTCCGGGAGAGCGCCGCGGTGGTGCTCGGGCACCGGGACGCCGGCAGT
TTCGACCTCGACCGGTCCTTCAAGGACCACGGCTTCGACTCGCTCAGCGCGGTCAAGCTG
CGCAACCGTCTGCGCGACTTCACCGGCGTGGAGCTGCCCAGCACCCTGATCTTCGACTAC
CCGAACCCGGCCGTCCTCGCGGACCACCTGCGGGCCGAACTGCTCGGCGAGCGCCCGGCC
GCGCCGGCCCCGGTGACGAGGGACGTCTCCGACGAGCCGATCGCGATCGTCGGCATGAGC
ACCCGGCTGCCGGGTGGCGCCGACAGCCCCGAAGAGCTGTGGAAGCTCGTCGCGGAGGGA
CGGGACGCCGTGTCCGGCTTCCCCGTCGACCGCGGCTGGGACCTCGACGGCCTCTACCAC
CCGGACCCCGCCCACGCCGGGACGAGCTACACGCGTTCGGGCGGCTTCCTGCACGACGCG
GCCCAGTTCGACGCCGGGCTCTTCGGGATCTCACCGCGTGAGGCCCTGGCCATGGACCCG
CAGCAGCGGCTGCTGCTGGAGACGTCGTGGGAAGCCTTGGAGCGCGCGGGGGTCGACCCG
CTGTCCGCCCGCGGCAGCGACGTCGGCGTCTTCACCGGGATCGTCCACCACGACTACGTG
ACGCGGCTGCGCGAAGTGCCCGAAGACGTCCAGGGCTACACGATGACCGGCACGGCTTCG
AGCGTGGCGTCGGGCCGGGTGGCGTACGTCTTCGGCTTCGAGGGCCCGGCGGTCACCGTG
GACACCGCGTGTTCGTCGTCGCTGGTCGCGATGCACCTGGCGGCGCAGGCGCTGCGGCAG
GGGGAGTGCTCGATGGCCCTGGCCGGCGGCGCGACCGTGATGGCCAGCCCGGACGCCTTC
CTCGAGTTCTCCCGCCAGCGCGGCCTGTCCGCGGACGGCCGGTGCAAGGCGTACGCGGAA
GGCGCGGACGGCACGGGCTGGGCCGAGGGCGTCGGTGTCGTCGTCCTCGAACGGCTTTCG
GTGGCACGCGAACGTGGCCACCGGGTGCTGGCGGTCCTGCGCGGCAGCGCGGTGAACCAG
GACGGTGCTTCCAACGGCCTGACCGCCCCGAACGGGCCGTCGCAGCAGCGGGTGATCCGC
GGCGCGCTGGCGAGCGCCGGGCTGGCACCGTCCGATGTGGACGTCGTGGAGGGCCACGGG
ACCGGGACCGCGCTGGGTGACCCGATCGAGGTCCAGGCGCTGCTGGCCACCTACGGGCAG
GAGCGGGAACAGCCGTTGTGGCTCGGCTCGCTGAAGTCGAACCTCGGGCACACGCAGGCC
GCGGCCGGGGTCGTGGGCGTGATCAAGATGATCATGGCCATGCGCCACGGCGTCATGCCG
GCCACGCTGCACGTCGACGAGCGCACGAGCCAGGTCGACTGGTCGGCGGGCGCGATCGAG
GTGTTGACCGAGGCCCGGGAGTGGCCGCGCACCGGACGTCCGCGCCGGGCCGGGGTGTCC
TCCTTCGGCGCCAGCGGCACCAACGCGCACCTGATCATCGAGGAAGGTCCCGCCGAAGAG
GCCGTGGACGAAGAGGTGGCCTCCGTGGTGCCGCTGGTCGTCTCCGCCCGCAGCGCCGGT
TCGCTGGCCGGGCAGGCCGGGCGCCTGGCCGCGGTCCTCGAGAACGAATCGTTGGCCGGG
GTGGCCGGTGCCCTGGTTTCCGGCCGCGCGACGCTGAACGAGCGCGCGGTCGTCATCGCG
GGCTCCCGCGACGAGGCCCAGGACGGCCTGCAGGCACTGGCCCGCGGCGAGAACGCGCCC
GGCGTCGTGACCGGGACGGCGGGCAAGCCGGGCAAGGTCGTCTGGGTCTTCCCCGGCCAG
GGCTCGCAGTGGATGGGCATGGGCCGGGACCTCCTGGACTCCTCGCCGGTGTTCGCCGCG
CGGATCAAGGAATGCGCTGCGGCACTGGAACAGTGGACCGACTGGTCGCTGCTGGACGTG
CTGCGCGGCGACGCCGACCTGCTGGACCGGGTCGACGTGGTGCAGCCGGCCAGCTTCGCG
ATGATGGTCGGGCTCGCCGCGGTGTGGACCTCGCTGGGGGTGACCCCGGATGCGGTGCTC
GGCCACTCCCAGGGCGAGATCGCCGCGGCGTGCGTGTCCGGCGCGCTGTCGCTGGACGAC
GCGGCGAAGGTGGTCGCGTTGCGCAGCCAGGCGATCGCGGGGGAGCTGGCGGGCCGCGGC
GGGATGGCGTCGGTCGCACTGAGCGAAGAGGACGCAGTCGCGCGGCTGACGCCGTGGGCG
AACCGGGTCGAGGTGGCCGCGGTCAACAGCCCGTCCTCGGTCGTCATCGCGGGAGACGCG
CAGGCCCTCGACGAAGCCCTCGAAGCCCTGGCCGGCGACGGTGTCCGGGTCCGGCGGGTC
GCGGTGGACTACGCCTCCCACACCCGGCACGTCGAGGCGATCGCCGAAACCCTGGCCAAG
ACCTTGGCCGGGATCGACGCGCGGGTTCCGGCGATTCCGTTCTATTCCACCGTCCTGGGC
ACGTGGATCGAGCAGGCCGTCGTCGACGCGGGCTACTGGTACCGGAACCTGCGGCAGCAG
GTGCGGTTCGGCCCCTCGGTGGCGGACCTGGCCGGGCTGGGGCACACGGTGTTCGTGGAG
ATCAGCGCCCACCCGGTGCTGGTCCAGCCGCTGAGCGAGATCAGCGACGACGCGGTGGTG
ACCGGGTCGCTGCGGCGGGACGACGGGGGACTGCGGCGCCTGCTGGCGTCGGCGGCCGAA
CTGTACGTCCGGGGCGTGGCCGTGGACTGGACGGCGGCCGTGCCCGCGGCCGGCTGGGTG
GACCTGCCGACGTACGCCTTCGACCGCCGCCACTTCTGGCTGCACGAAGCCGAGACCGCC
GAAGCCGCCGAGGGCATGGACGGCGAGTTCTGGACGGCGATCGAACAGTCCGATGTGGAC
AGCTTGGCCGAGCTGCTCGAGCTGGTGCCGGAGCAGCGCGGGGCGCTCAGCACCGTCGTG
CCCGTGCTGGCGCAGTGGCGGGACCGGCGCCGCGAGCGCTCGACCGCGGAGAAGCTGCGC
TACCAGGTCACCTGGCAGCCCCTGGAGCGCGAAGCCGCCGGCGTGCCGGGCGGGCGCTGG
CTGGCCGTCGTCCCGGCCGGCACCACCGACGCGCTCCTGAAGGAGCTGACCGGCCAGGGA
CTCGACATCGTCCGGCTGGAGATCGAGGAAGCTTCGCGGGCACAGCTCGCCGAGCAGCTG
CGGAACGTCCTGGCGGAGCACGACCTCACCGGCGTGCTGTCGCTGCTCGCTCTCGACGGC
GGCCCCGCGGACGCGGCCGAGATCACCGCGTCGACGCTCGCGCTGGTCCAGGCCCTGGGC
GACACCACCACGTCCGCGCCGCTGTGGTGCCTCACTTCCGGCGCGGTGAACATCGGCATC
CAGGACGCCGTGACCGCACCGGCCCAGGCGGCCGTGTGGGGGCTCGGCCGGGCCGTCGCG
CTGGAGCGCCTCGACCGGTGGGGCGGCCTGGTCGACTTGCCCGCCGCGATCGACGCCCGC
ACGGCTCAGGCCCTGCTCGGCGTCCTGAACGGCGCCGCCGGGGAAGACCAGCTCGCGGTC
CGGCGCTCGGGCGTCTACCGCAGGCGGCTGGTCCGCAAGCCCGTGCCGGAGTCCGCGACG
AGCCGGTGGGAACCCCGCGGCACGGTCCTGGTGACCGGTGGGGCCGAAGGACTCGGCCGG
CACGCCTCGGTCTGGCTCGCGCAGTCCGGCGCCGAACGGCTCATCGTCACCGGCACCGAC
GGCGTCGACGAACTGACGGCCGAGCTGGCCGAGTTCGGCACCACGGTCGAGTTCTGCGCC
GACACCGACCGGGACGCGATCGCGCAGCTGGTGGCGGACTCGGAGGTCACCGCCGTGGTG
CACGCCGCGGACATCGCGCAGACCAGCTCCGTCGACGACACCGGCGTGGCCGACCTCGAC
GAGGTGTTCGCCGCGAAGGTGACCACCGCGGTGTGGCTGGACCAGCTGTTCGAGGACACC
CCGCTCGACGCGTTCGTCGTGTTCTCCTCGATCGCCGGCATCTGGGGCGGTGGCGGGCAG
GGCCCGGCGGGTGCGGCGAACGCCGTCCTCGACGCCCTGGTCGAATGGCGCCGGGCCCGC
GGCCTCAAGGCGACGTCGATCGCCTGGGGCGCGCTCGACCAGATCGGCATCGGCATGGAC
GAGGCCGCCCTCGCCCAGCTGCGCCGCCGCGGTGTCATCCCGATGGCGCCGCCGCTGGCG
GTCACCGCGATGGTGCAGGCGGTCGCCGGCAACGAGAAGGCCGTGGCGGTGGCCGACATG
GACTGGGCCGCCTTCATCCCGGCGTTCACCTCGGTCCGGCCCAGCCCGCTGTTCGCCGAT
CTGCCCGAGGCGAAGGCCATCCTCCGGGCGGCGCAGGACGACGGCGAAGACGGCGACACC
GCGTCGTCGCTCGCGGACTCCCTGCGCGCGGTCCCCGACGCCGAGCAGAACCGCATCCTG
CTGAAGCTGGTCCGCGGCCACGCTTCGACGGTGCTCGGCCACAGCGGCGCCGAAGGCATC
GGCCCGCGCCAGGCGTTCCAGGAGGTCGGCTTCGACTCGCTGGCCGCGGTCAACCTCCGC
AACAGCCTGCACGCGGCCACCGGGCTGCGGCTGCCCGCGACGCTGATCTTCGACTACCCC
ACCCCGGAGGCGCTGGTCGGCTACCTGCGCGTCGAACTCCTGCGGGAGGCCGACGACGGC
CTGGACGGGCGGGAAGACGACCTCCGGCGAGTCCTCGCGGCCGTGCCGTTCGCCCGGTTC
AAGGAGGCGGGCGTGCTGGACACGCTGCTCGGCCTCGCCGACACCGGCACCGAACCGGGC
ACGGACGCCGAGACCACCGAAGCGGCCCCGGCCGCCGACGACGCAGAACTGATCGACGCA
CTGGACATCTCCGGTCTCGTGCAACGAGCCCTCGGGCAGACGAGCTGA
[0] A34..436
[0] PCP541..611
[1] KS632..1004
[1] AT1144..1453
[1] methylmalonyl-CoA1330..1334
[1] dh1489..1634
[1] KR1829..2005
[1] ACP2104..2174
[2] KS2195..2568
[2] AT2717..3025
[2] malonyl-CoA2902..2906
[2] ACP3077..3151
[3] KS3171..3546
[3] AT3694..4008
[3] methylmalonyl-CoA3884..3888
[3] kr4307..4475
[3] ACP4580..4650
[0] A100..1308
[0] PCP1621..1833
[1] KS1894..3012
[1] AT3430..4359
[1] methylmalonyl-CoA3988..4002
[1] dh4465..4902
[1] KR5485..6015
[1] ACP6310..6522
[2] KS6583..7704
[2] AT8149..9075
[2] malonyl-CoA8704..8718
[2] ACP9229..9453
[3] KS9511..10638
[3] AT11080..12024
[3] methylmalonyl-CoA11650..11664
[3] kr12919..13425
[3] ACP13738..13950

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [34-436]  2.7e-114 PF00501
PF00501   AMP-binding
IPR001227 Acyl transferase domain (Domain)
 [1329-1441]  2.7e-69 G3DSA:3.40.366.10 [2902-3015]  1.2e-71 G3DSA:3.40.366.10 [3883-3996]  9.7e-73 G3DSA:3.40.366.10
G3DSA:3.40.366.10   no description
IPR006162 Phosphopantetheine attachment site (PTM)
 [2132-2147]  PS00012 [4608-4623]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [545-614]  3.9e-15 G3DSA:1.10.1200.10 [2103-2177]  1.5e-18 G3DSA:1.10.1200.10 [3079-3154]  1.2e-18 G3DSA:1.10.1200.10 [4580-4651]  4.2e-17 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   no description
 [541-611]  17.629 PS50075 [2104-2174]  18.678 PS50075 [3077-3151]  19.682 PS50075 [4580-4650]  18.428 PS50075
PS50075   ACP_DOMAIN
 [538-648]  5.5e-26 SSF47336 [2097-2211]  9.4e-27 SSF47336 [3074-3188]  4.2e-29 SSF47336 [4572-4667]  2e-20 SSF47336
SSF47336   ACP-like
 [548-610]  3.9e-09 PF00550 [2107-2173]  1.1e-09 PF00550 [3084-3150]  1.7e-12 PF00550 [4584-4649]  1.3e-09 PF00550
PF00550   PP-binding
IPR013968 Polyketide synthase, KR (Domain)
 [1829-2004]  5.2e-59 PF08659 [4307-4474]  2.7e-44 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [632-879]  6.1e-94 PF00109 [2195-2444]  2e-95 PF00109 [3171-3421]  4.3e-97 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [888-1004]  1.5e-49 PF02801 [2452-2568]  2.7e-49 PF02801 [3430-3546]  9.9e-49 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [1144-1453]  1.5e-99 PF00698 [2717-3025]  7e-62 PF00698 [3694-4008]  2.9e-101 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [1142-1424]  5.3e-65 SSF52151 [2713-3017]  1.1e-68 SSF52151 [3692-3977]  4.2e-66 SSF52151
SSF52151   FabD/lysophospholipase-like
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [1267-1329]  6.3e-17 SSF55048 [2839-2901]  2.3e-17 SSF55048 [3818-3883]  5.7e-19 SSF55048
SSF55048   Probable ACP-binding domain of malonyl-CoA ACP transacylase
IPR016038 Thiolase-like, subgroup (Domain)
 [634-892]  6.4e-89 G3DSA:3.40.47.10 [893-1058]  4e-65 G3DSA:3.40.47.10 [2194-2455]  5.3e-86 G3DSA:3.40.47.10 [2456-2619]  7.4e-64 G3DSA:3.40.47.10 [3174-3434]  4.7e-88 G3DSA:3.40.47.10 [3435-3598]  1.2e-62 G3DSA:3.40.47.10
G3DSA:3.40.47.10   no description
IPR016039 Thiolase-like (Domain)
 [624-1002]  7.7e-104 SSF53901 [2194-2620]  5.4e-101 SSF53901 [3164-3544]  5e-103 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1830-2011]  2e-35 G3DSA:3.40.50.720 [4307-4507]  2.1e-21 G3DSA:3.40.50.720
G3DSA:3.40.50.720   no description
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [793-809]  PS00606 [2357-2373]  PS00606 [3335-3351]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [1146-1433]  2.6e-112 SM00827 [2717-3006]  2.7e-119 SM00827 [3696-3988]  1.4e-115 SM00827
SM00827   Acyl transferase domain in polyketide syntha
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [546-614]  8.1e-23 SM00823 [2105-2177]  2.1e-27 SM00823 [3082-3154]  1.8e-28 SM00823 [4581-4653]  1.7e-26 SM00823
SM00823   Phosphopantetheine attachment site
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [1489-1634]  1.5e-24 SM00826
SM00826   no description
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [634-1056]  3.6e-221 SM00825 [2197-2620]  5.2e-214 SM00825 [3174-3598]  6.1e-218 SM00825
SM00825   Beta-ketoacyl synthase
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1829-2005]  3.7e-57 SM00822 [4307-4475]  2.1e-27 SM00822
SM00822   no description
IPR020845 AMP-binding, conserved site (Conserved_site)
 [164-175]  PS00455
PS00455   AMP_BINDING
IPR025110 Domain of unknown function DUF4009 (Domain)
 [475-502]  4.4e-06 PF13193
PF13193   DUF4009
SignalP
 [1-27]  0.179 Signal
Eukaryota   
 [1-27]  0.196 Signal
Bacteria, Gram-positive   
 [1-27]  0.167 Signal
Bacteria, Gram-negative   
TMHMM No significant hit