close all open/close all

CDS information : Rifam_00220


close this sectionLocation

Organism
StrainS699
Entry nameRifamycin
Contig
Start / Stop / Direction31,982 / 47,164 / + [in whole cluster]
31,982 / 47,164 / + [in contig]
Location31982..47164 [in whole cluster]
31982..47164 [in contig]
TypeCDS
Length15,183 bp (5,060 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)RifB
Gene
Gene (GenBank)rifB
EC number
Keyword
Note
Note (GenBank)
  • rifamycin polyketide synthase
Reference
ACC
PmId
[9512878] Biosynthesis of the ansamycin antibiotic rifamycin: deductions from the molecular analysis of the rif biosynthetic gene cluster of Amycolatopsis mediterranei S699. (Chem Biol. , 1998)
[10430893] Direct evidence that the rifamycin polyketide synthase assembles polyketide chains processively. (Proc Natl Acad Sci U S A. , 1999)
[24923585] Modification of Rifamycin Polyketide Backbone Leads to Improved Drug Activity Against Rifampicin-Resistant Mycobacterium tuberculosis* (J Biol Chem. , 2014)
[27246853] Protein-Protein Interactions, Not Substrate Recognition, Dominate the Turnover of Chimeric Assembly Line Polyketide Synthases. (J Biol Chem. , 2016)

close this sectionPKS/NRPS Module

4 methylmalonyl-CoA
5 methylmalonyl-CoA
6 methylmalonyl-CoA
KS35..411
AT561..877
DH923..1085
KR1346..1519
ACP1624..1694
KS1717..2090
AT2241..2548
dh2592..2726
KR2954..3126
ACP3231..3301
KS3322..3698
AT3847..4160
dh4207..4369
KR4657..4833
ACP4932..5002

close this sectionSequence

selected fasta
>polyketide synthase [RifB]
MSAPNEQIVDALRASLKENVRLQQENSALAAAAAEPVAIVSMACRYAGGIRGPEDFWRVV
SEGADVYTGFPEDRGWDVEGLYHPDPDNPGTTYVREGAFLQDAAQFDAGFFGISPREALA
MDPQQRQLLEVSWETLERAGIDPHSVRGSDIGVYAGVVHQDYAPDLSGFEGFMSLERALG
TAGGVASGRVAYTLGLEGPAVTVDTMCSSSLVAIHLAAQALRRGECSMALAGGSTVMATP
GGFVGFARQRALAFDGRCKSYAAAADGSGWAEGVGVLLLERLSVARERGHQVLAVIRGSA
VNQDGASNGLTAPNGPAQQRVIRKALASAGLTPSDVDTVEGHGTGTVLGDPIEVQALLAT
YGQGRDPQQPLWLGSVKSVVGHTQAASGVAGVIKMVQSLRHGQLPATQHVDAPTPQVDWS
AGAIELLAEGREWPRNGHPRRGGISSFGASGTNAHMILEEAPEDEPVTEAPAPTGVVPLV
VSAATAASLAAQAGRLAEVGDVSLADVAGTLVSGRAMLSERAVVVAGSHEEAVTGLRALA
RGESAPGLLSGRGSGVPGKVVWVFPGQGTQWAGMGRELLDSSEVFAARIAECETALGRWV
DWSLTDVLRGEADLLDRVDVVQPASFAVMVGLAAVWASLGVEPEAVVGHSQGEIAAACVS
GALSLEDAAKVVALRSQAIAASLAGRGGMASVALSEEDATARLEPWAGRVEVAAVNGPTS
VVIAGDAEALDEALDALDDQGVRIRRVAVDYASHTRHVEAARDALAEMLGGIRAQAPEVP
FYSTVTGGWVEDAGVLDGGYWYRNLRRQVRFGPAVAELIEQGHRVFVEVSAHPVLVQPIN
ELVDDTEAVVTGTLRREDGGLRRLLASAAELFVRGVTVDWSGVLPPSRRVELPTYAFDHQ
HYWLQMGGSATDAVSLGLAGADHPLLGAVVPLPQSDGLVFTSRLSLKSHPWLAGHAIGGV
VLIPGTVYVDLALRAGDELGFGVLEELVIEAPLVLGERGGVRVQVAVSGPNETGSRAVDV
FSMREDGDEWTRHATGLLGASTSREPSRFDFAAWPPAGAEPIDVENFYTDLTERGYAYSG
AFQGMRAVWRRGDEVFAEVALPDDHREDAGKFGLHPALLDAALHTNAFANPDDDRSVLPF
AWNGLVLHAVGASALRVRVAPGGPDALTFQAADETGGLVVTMDSLVSREVSAAQLETAAG
EERDSLFQVDWIEVPATETAATEHAEVLEAFGEAAPLELTSRVLEAVQSWLADAADEARL
VVVTRGAVREVTDPAGAAVWGLVRAAQAENPGRIILVDTDGDVPLGAVLASGEPQLAVRG
NAFSVPRLARATGEVPEAPAVFSPEGTVLLTGGTGSLGGLVAKHLVARHGVRRLVLASRR
GVAAEDLVTELTEQGATVSVVACDVSDRDQVAALLAEHRPTGIVHLAGLLDDGVIGALNR
ERLAGVFAPKVDAVQHLDELTRDLGLDAFVVFSSAAALMGSAGQGNYAAANAFLDGLMAG
RRAAGLPGVSLAWGLWEQADGLTANLSATDQARMSRGGVLPMTPAEALDIFDIGLAAEQA
LLVPIKLDLRTLRGQATAGGEVPHLLRGLVRASRRVTRTAAASGGGGLVHKLAGRPAEEQ
EAVLLGIVQAEAAAVLGFNAPELAQGTRGFSDLGFDSLTAVELRNRLSAATGVKLPATLV
FDYPTPVALARHLREELGETVAGAPATPVTTVADAGEPIAIVGMACRLPGGVMSPDDLWR
MVAEGRDGMSPFPGDRGWDLDGLFDSDPERPGTAYIRQGGFLHEAALFDPGFFGISPREA
LAMDPQQRLLLEASWEALERAGIDPTKARGDAVGVFSGVSIHDYLESLSNMPAELEGFVT
TATAGSVASGRVSYTFGFEGPAVTVDTACSSSLVAIHLAAQALRQGECTMALAGGVAVMG
SPIGVIGMSRQRGMAEDGRVKAFADGADGTVLSEGVGIVVLERLSVARERGHRVLAVLRG
SAVNQDGASNGLTAPNGPSQQRVIRSALAGAGLQPSEVDVVEAHGTGTALGDPIEAQALL
ATYGKSRETPLWLGSLKSNIGHTQAAAGVAAVIKMVQALRHDTLPPTLHVQEPTKQVDWS
AGAVELLTEGREWARNGHPRRAGVSSFGISGTNAHLILEEAPADDTAEADVPDAVVPVVI
SARSTGSLAGQAGRLAAFLDGDVPLTRVAGALLSTRATLTDRAVVVAGSAEEARAGLTAL
ARGESASGLVTGTAGMPGKTVWVFPGQGTQWAGMGRELLEASPVFAERIEECAAALQPWI
DWSLLDVLRGEGELDRVDVLQPACFAVMVGLAAVWASVGVVPDAVLGHSQGEIAAACVSG
ALSLEDAAKVVALRSQAIAAELSGRGGMASIQLSHDEVAARLAPWAGRVEIAAVNGPASV
VIAGDAEALTEAVEVLGGRRVAVDYASHTRHVEDIQDTLAETLAGIDAQAPVVPFYSTVA
GEWITDAGVVDGGYWYRNLRNQVGFGPAVAELIEQGHGVFVEVSAHPVLVQPISELTDAV
VTGTLRRDDGGVRRLLTSMAELFVRGVPVDWATMAPPARVELPTYAFDHQHFWLSPPAVA
DAPALGLAGADHPLLGAVLPLPQSDGLVFTSRLSVRTHPWLADGVPAAALVELAVRAGDE
AGCPVLADLTVEKLLVLPESGGLRVQVIVSGERTVEVYSQLEGAEDWIRNATGHLSATAP
AHEAFDFTAWPPAGAQQVDGLWRRGDEIFAEVALPEELDAGAFGIHPFLLDAAVQPVLAD
DEQPAEWRSLVLHAAGASALRVRLVPGGALQAADETGGLVLTADSVAGRELSAGKTRAGS
LYRVDWTEVSIADSAVPANIEVVEAFGEEPLELTGRVLEAVQTWLVTAADDARLVVVTRG
AVREVTDPAGAAVWGLVRAAQAENPGRIFLIDTDGEIPALTGDEPEIAVRGGKFFVPRIT
RAEPSGAAVFRPDGTVLISGAGALGGLVARRLVERHGVRKLVLASRRGRDADGVADLVAD
LAADVSVVACDVSDRAQVAALLDEHRPTAVVHTAGVIDAGVIETLDRDRLATVFAPKVDA
VRHLDELTRDRDLDAFVVYSSVSAVFMGAGSGSYAAANAFLDGLMANRRAAGLPGLSLAW
GLWDQSTGMAAGTDEATRARMSRRGGLQIMTQAEGMDLFDAALSSAESLLVPAKLDLRGV
RADAAAGGVVPHMLRGLVRAGRAQARAASTVDNGLAGRLAGLAPADQLTLLLDLVRAQVA
AVLGHADASAVRVDTAFKDAGFDSLTAVELRNRMRTATGLKLPATLVFDYPNPQALARHL
RDELGGAAQTPVTTAAAKADLDEPIAIVGMACRLPGGVAGPEDLWRLVAEGRDAVSSFPT
DRGWDTDSLYDPDPARPGKTYTRHGGFLHEAGLFDAGFFGISPREAVAMDPQQRLLLEAS
WEAMEDAGVDPLSLKGNDVGVFTGMFGQGYVAPGDSVVTPELEGFAGTGGSSSVASGRVS
YVFGFEGPAVTIDSACSSSLVAMHLAAQSLRQGECSMALAGGATVMANPGAFVEFSRQRG
LAVDGRCKAFAAAADGTGWAEGVGVVILERLSVARERGHRILAVLRGSAVNQDGASNGLT
APNGPSQQRVIRRALVSAGLAPSDVDVVEAHGTGTTLGDPIEAQALLATYGKDRESPLWL
GSLKSNIGHAQAAAGVAGVIKMVQALRHEVLPPTLHVDRPTPEVDWSAGAVELLTEAREW
PRNGRPRRAGVSAFGVSGTNAHLILEEAPAEEPVPTPEVPLVPVVVSARSRASLAGQAGR
LAGFVAGDASLAGVARALVTNRAALTERAVMVVGSREEAVTNLEALARGEDPAAVVTGRA
GSPGKLVWVFPGQGSQWIGMGRELLDSSPVFAERVAECAAALEPWIDWSLLDVLRGESDL
LDRVDVVQPASFAMMVGLAAVWQSVGVRPDAVVGHSQGEIAAACVSGALSLQDAAKVVAL
RSQAIATRLAGRGGMASVALSEEDATAWLAPWADRVQVAAVNSPASVVIAGEAQALDEVV
DALSGQEVRVRRVAVDYGSHTNQVEAIEDLLAETLAGIEAQAPKVPFYSTLIGDWIRDAG
IVDGGYWYRNLRNQVGFGPAVAELVRQGHGVFVEVSAHPVLVQPLSELSDDAVVTGSLRR
EDGGLRRLLTSMAELYVQGVPLDWTAVLPRTGRVDLPKYAFDHRHYWLRPAESATDAASL
GQGAADHPLLGAVVELPQSDGLVFTSRLSVRTHPWLADHAVGGVVILPGSGLAELAVRAG
DEAGCTALDELIIEAPLVVPAQGAVRVQVALSGPDETGSRTVDLYSQRDGGAGTWTRHAT
GVPSTAPAQEPEFDFHAWPPADAERIDVETFYTDLAERGYGYGPAFQGLQAVWRRDGDVF
AEVALPEDLRKDAGRFGVHPALLDAALQAATAVGGDEPGQPVLAFAWNGLVLHAAGASAL
RVRLAPSGPDTLSVAAADETGGLVLTMESLVSRPVSAEQLGAAADAGHDAMFRVDWTELP
AVPRAELPPWVRIDTADDVAALAEKADAPPVVVWEAAGGDPALAVSSRVLEIMQAWLAAP
AFEEARLVVTTRGAVPAGGDHTLTDPAAAAVWGLVRSAQAEHPDRVVLLDTDGEVPLGAV
LASGEPQLAVRGTTFFVPRLARATRLSDAPPAFDPDGTVLVSGAGSLGTLVARHLVTRHG
VRRVVLASRQGRDAEGAQDLITELTGEGADVSFVACDVSDRDQVAALLAGLPDLTGVVHT
AGVFEDGVIEALTPDQLANVYAAKVTAAMHLDELTRDRDLGAFVVFSSVAGVMGGGGQGP
YAAANAFLDAAMASRQAAGLPGLSLAWGLWERSSGMAAHLSEVDHARASRNGVLELTRAE
GLALFDLGLRMAESLLVPIKLDLAAMRASTVPVLFRGLVRPSRTQARTASTVDRGLAGRL
AGLPVAERAAVLVDLVRGQVAVVLGYDGPEAVRPDTAFKDTGFDSLTSVELRNRLREATG
LKLPATLVFDYPNPLAVARYLGARLVPDGTANGNGNGNGHSEDDRLRHALAAIAAEDAGE
ERSIADLGVDDLVQLAFGDE
selected fasta
>polyketide synthase [RifB]
ATGTCCGCGCCGAACGAGCAGATCGTTGACGCACTGCGCGCGTCGCTGAAGGAGAACGTC
CGGCTTCAGCAGGAGAACAGCGCGCTCGCCGCGGCCGCCGCGGAGCCCGTCGCGATCGTC
TCCATGGCCTGCCGCTACGCGGGCGGGATCCGCGGCCCGGAGGACTTCTGGCGGGTGGTG
TCGGAAGGCGCCGACGTCTACACCGGCTTCCCCGAGGACCGCGGCTGGGACGTCGAAGGC
CTCTACCACCCGGACCCCGACAACCCCGGCACGACGTACGTGCGGGAGGGCGCCTTCCTG
CAGGACGCGGCCCAGTTCGACGCCGGGTTCTTCGGCATCTCGCCGCGCGAGGCGCTGGCC
ATGGACCCCCAGCAGCGGCAGCTCCTGGAGGTGTCCTGGGAGACCTTGGAACGGGCCGGC
ATCGACCCGCATTCGGTGCGGGGCAGCGACATCGGCGTCTACGCCGGGGTCGTGCACCAG
GACTACGCCCCCGACCTCAGCGGGTTCGAAGGCTTCATGAGCCTGGAGCGCGCCCTGGGC
ACCGCGGGCGGTGTCGCCTCCGGCCGGGTCGCCTACACGCTCGGGCTCGAAGGCCCCGCC
GTCACCGTCGACACGATGTGCTCGTCGTCGCTGGTGGCGATTCACCTTGCCGCGCAAGCT
CTTCGCCGTGGTGAGTGCTCGATGGCCCTCGCGGGCGGCTCGACCGTGATGGCGACCCCG
GGCGGGTTCGTCGGCTTCGCGCGTCAGCGGGCGTTGGCCTTCGACGGGCGCTGCAAGTCC
TACGCCGCGGCCGCCGACGGTTCCGGCTGGGCCGAGGGCGTCGGCGTGCTGCTGCTGGAG
CGGCTGTCGGTGGCGCGCGAGCGCGGGCACCAGGTGCTGGCCGTCATCCGCGGCAGCGCG
GTCAACCAGGACGGCGCTTCCAACGGCCTGACCGCGCCCAACGGCCCGGCGCAGCAGCGG
GTCATCCGCAAGGCACTGGCGAGCGCCGGGCTGACACCGTCCGATGTGGACACCGTGGAG
GGCCACGGCACCGGCACCGTCCTCGGCGACCCGATCGAGGTCCAGGCGCTGCTGGCCACC
TACGGCCAGGGCCGCGACCCGCAGCAACCGCTGTGGCTGGGCTCGGTCAAGTCCGTCGTC
GGGCACACGCAGGCGGCATCCGGTGTGGCCGGCGTGATCAAGATGGTCCAGTCGCTGCGG
CACGGGCAGCTCCCGGCGACCCAGCACGTCGACGCGCCCACGCCGCAAGTGGACTGGTCG
GCCGGAGCGATCGAGCTGCTGGCCGAGGGCCGGGAGTGGCCGCGCAACGGCCACCCGCGC
CGGGGCGGCATCTCGTCGTTCGGGGCCAGCGGCACGAACGCGCACATGATCCTCGAAGAA
GCGCCCGAGGACGAGCCGGTGACCGAAGCGCCGGCGCCCACGGGTGTCGTACCGCTGGTG
GTGTCGGCGGCGACCGCTGCTTCCCTGGCCGCCCAGGCCGGTCGGCTGGCGGAGGTCGGC
GACGTCTCCCTGGCGGATGTCGCCGGGACGCTGGTGTCCGGCCGCGCGATGCTCAGCGAG
CGCGCGGTCGTCGTGGCCGGCTCCCACGAAGAAGCCGTGACCGGGCTGCGGGCGCTGGCC
CGCGGCGAGAGCGCGCCCGGCCTGCTTTCCGGCCGCGGCTCGGGGGTCCCGGGCAAGGTC
GTCTGGGTGTTCCCCGGCCAGGGCACGCAGTGGGCCGGCATGGGCCGCGAGCTGCTGGAC
TCCTCGGAGGTGTTCGCCGCGCGGATCGCCGAGTGCGAGACCGCGCTCGGGCGGTGGGTC
GACTGGTCGCTGACCGACGTGCTGCGCGGCGAGGCCGACCTGCTGGACCGGGTCGACGTG
GTGCAACCGGCGAGCTTCGCCGTGATGGTCGGGCTTGCCGCCGTCTGGGCCTCCCTCGGC
GTCGAGCCCGAGGCCGTGGTGGGCCACTCGCAGGGCGAGATCGCGGCCGCATGCGTGTCC
GGGGCACTGTCCCTGGAGGACGCGGCGAAGGTGGTGGCGTTGCGCAGCCAGGCGATCGCC
GCCTCGCTGGCCGGCCGGGGCGGCATGGCGTCGGTCGCGTTGAGCGAAGAAGACGCGACC
GCGCGGCTCGAGCCGTGGGCGGGCCGCGTGGAGGTCGCCGCCGTCAACGGGCCGACGTCC
GTGGTGATCGCCGGGGACGCCGAGGCGCTGGACGAAGCCCTCGACGCGCTCGACGACCAA
GGCGTCCGGATCCGGCGGGTGGCGGTGGACTACGCCTCCCACACCCGGCACGTCGAAGCC
GCGCGCGACGCACTGGCCGAGATGCTGGGCGGGATCCGCGCGCAGGCGCCGGAAGTGCCG
TTCTACTCGACCGTGACCGGCGGCTGGGTCGAAGACGCCGGCGTGCTCGACGGCGGCTAC
TGGTACCGGAACCTCCGCCGTCAGGTGCGGTTCGGCCCGGCGGTGGCCGAGCTGATCGAG
CAGGGCCACCGGGTGTTCGTCGAGGTCAGCGCGCATCCCGTGCTGGTTCAGCCGATCAAC
GAACTCGTCGACGACACCGAAGCCGTGGTCACCGGGACGCTGCGGCGCGAGGACGGCGGC
CTCCGGCGCCTGCTGGCCTCGGCGGCCGAGCTCTTCGTCCGCGGCGTGACCGTGGACTGG
TCCGGTGTGCTGCCACCGTCCCGCCGGGTCGAGCTGCCGACGTACGCCTTCGACCACCAG
CACTACTGGCTGCAGATGGGCGGGTCGGCCACCGACGCCGTGTCGCTGGGCCTGGCCGGC
GCCGACCACCCGCTGCTGGGCGCGGTCGTCCCGCTGCCGCAGTCCGACGGGCTCGTCTTC
ACCTCGCGGCTGTCGCTGAAGTCGCACCCGTGGCTGGCCGGGCACGCGATCGGCGGGGTC
GTGCTCATTCCGGGCACGGTGTACGTCGACCTCGCGCTGCGCGCCGGCGACGAGCTCGGC
TTCGGCGTCCTGGAAGAGCTCGTGATCGAGGCACCGCTGGTGCTGGGCGAGCGCGGCGGC
GTTCGCGTGCAGGTCGCCGTGAGCGGGCCGAACGAGACCGGCTCGCGTGCGGTGGACGTC
TTCTCCATGCGGGAAGACGGCGACGAATGGACCCGGCACGCGACCGGTCTCCTCGGGGCG
TCGACGTCCCGGGAACCGAGCCGCTTCGACTTCGCCGCCTGGCCGCCGGCCGGGGCGGAG
CCGATCGACGTCGAAAACTTCTACACCGACCTCACCGAGCGCGGGTACGCCTACAGCGGC
GCCTTCCAGGGCATGCGGGCGGTCTGGCGGCGCGGTGACGAGGTCTTCGCCGAGGTCGCG
CTGCCTGACGACCACCGCGAGGACGCCGGCAAGTTCGGCCTCCACCCCGCCCTCCTCGAC
GCCGCTCTGCACACGAACGCCTTCGCGAACCCGGACGACGACCGCAGTGTGCTGCCGTTC
GCGTGGAACGGCCTGGTCCTGCACGCCGTGGGCGCGTCGGCGCTGCGGGTGCGGGTGGCG
CCGGGCGGTCCGGACGCGCTGACGTTCCAGGCCGCCGACGAGACCGGTGGCCTGGTCGTC
ACCATGGATTCGCTGGTGTCCCGCGAGGTGTCGGCCGCGCAGCTGGAGACGGCGGCGGGC
GAAGAGCGCGACTCGCTGTTCCAGGTGGACTGGATCGAGGTCCCCGCGACCGAGACCGCG
GCCACCGAGCACGCCGAGGTGCTCGAAGCCTTCGGCGAGGCAGCGCCCCTCGAGCTGACC
AGCCGGGTGCTGGAGGCCGTGCAGTCCTGGCTCGCCGACGCGGCCGACGAAGCACGGTTG
GTCGTGGTGACCCGTGGCGCCGTGCGCGAGGTGACGGACCCGGCCGGTGCCGCCGTGTGG
GGTTTGGTGCGAGCCGCCCAGGCGGAGAACCCGGGCCGGATCATCCTCGTCGACACCGAC
GGCGACGTCCCGCTGGGTGCGGTGCTGGCCAGTGGTGAGCCGCAGCTCGCCGTGCGCGGC
AACGCTTTCTCCGTCCCGCGCCTCGCCCGGGCCACCGGCGAGGTGCCGGAGGCCCCCGCG
GTGTTCAGTCCGGAAGGGACGGTCCTGCTCACCGGCGGCACCGGCTCGCTGGGCGGTCTG
GTGGCCAAGCACCTGGTTGCCCGGCACGGCGTCCGGCGGCTGGTGCTCGCCAGCCGCCGA
GGCGTGGCCGCGGAAGACCTCGTCACCGAGCTGACCGAGCAGGGCGCGACGGTGTCCGTG
GTGGCTTGCGACGTCTCCGACCGCGACCAGGTGGCCGCGTTGCTGGCCGAACACCGCCCG
ACCGGCATCGTGCACCTGGCCGGCCTGCTGGACGACGGCGTCATCGGAGCCCTGAACCGG
GAGCGGCTGGCCGGGGTGTTCGCGCCCAAGGTCGATGCCGTCCAGCACCTCGACGAACTG
ACCCGCGACCTCGGCCTCGACGCGTTCGTCGTGTTCTCGTCCGCAGCCGCGCTCATGGGC
TCCGCCGGCCAGGGCAACTACGCGGCCGCCAACGCCTTCCTCGACGGCTTGATGGCCGGG
CGCCGCGCGGCGGGCCTGCCAGGCGTGTCCCTGGCGTGGGGCCTGTGGGAGCAGGCGGAC
GGCCTGACCGCGAACCTCAGCGCCACCGACCAGGCCCGGATGAGCCGCGGCGGCGTGCTG
CCGATGACACCGGCCGAGGCCCTGGACATCTTCGACATCGGCCTGGCCGCCGAGCAGGCC
CTGCTGGTCCCGATCAAGCTCGACCTGCGGACGCTGCGCGGCCAGGCCACCGCCGGCGGC
GAGGTGCCGCACCTGCTGCGCGGCCTGGTCCGCGCGAGCCGCCGCGTGACCCGCACGGCT
GCCGCGAGTGGCGGCGGTGGCCTGGTCCACAAGCTCGCCGGGCGGCCAGCCGAAGAGCAG
GAAGCCGTGCTGCTGGGCATCGTCCAGGCGGAGGCGGCCGCGGTGCTCGGCTTCAACGCC
CCCGAGCTGGCCCAGGGCACCCGCGGGTTCAGCGACCTCGGCTTCGACTCGCTGACCGCG
GTCGAGCTGCGGAACCGGCTGAGCGCGGCGACCGGCGTCAAATTGCCCGCCACGCTCGTC
TTCGACTACCCGACGCCGGTCGCGCTCGCCCGCCACCTGCGCGAAGAGCTGGGCGAGACG
GTGGCGGGTGCGCCGGCCACGCCGGTGACGACCGTCGCCGACGCGGGCGAGCCGATCGCC
ATCGTCGGCATGGCGTGCCGCCTGCCGGGCGGCGTGATGAGCCCCGACGACCTCTGGCGG
ATGGTCGCCGAGGGCCGCGATGGGATGTCGCCGTTCCCCGGAGACCGCGGCTGGGACCTG
GACGGCCTGTTCGACTCGGACCCCGAGCGCCCGGGCACCGCCTACATCCGCCAAGGCGGC
TTCCTGCACGAGGCCGCGCTGTTCGACCCGGGCTTCTTCGGGATCTCGCCGCGCGAAGCC
CTGGCCATGGACCCGCAGCAGCGGCTGCTGCTCGAAGCCTCCTGGGAAGCCCTGGAGCGC
GCGGGCATCGACCCGACCAAGGCCCGCGGTGACGCCGTCGGCGTCTTCTCCGGCGTCTCC
ATCCACGACTACCTCGAGTCCCTGAGCAACATGCCCGCCGAGCTCGAAGGCTTCGTCACC
ACGGCCACGGCGGGCAGCGTCGCCTCGGGCCGGGTGTCCTACACCTTCGGGTTCGAGGGC
CCGGCGGTCACGGTGGACACGGCGTGCTCGTCGTCGCTGGTCGCGATCCACCTGGCCGCA
CAGGCACTGCGGCAGGGCGAGTGCACGATGGCCCTGGCCGGCGGTGTCGCCGTGATGGGC
TCGCCGATCGGTGTCATCGGCATGTCGCGGCAGCGCGGCATGGCCGAGGACGGCCGGGTC
AAGGCGTTCGCCGACGGCGCGGACGGCACCGTCCTGTCCGAAGGCGTCGGCATCGTCGTC
CTCGAACGGCTTTCGGTGGCCCGCGAACGCGGGCACCGGGTGCTCGCCGTGCTCCGCGGC
AGCGCGGTCAACCAGGACGGCGCTTCGAACGGCCTGACCGCGCCCAACGGGCCGTCGCAG
CAGCGGGTGATCCGCAGCGCGCTGGCCGGGGCCGGACTGCAACCGTCCGAAGTGGACGTC
GTCGAGGCGCACGGCACCGGGACCGCGCTGGGCGACCCGATCGAGGCCCAGGCCCTGCTG
GCCACCTACGGCAAGAGCCGCGAGACGCCGTTGTGGCTCGGGTCGCTGAAGTCGAACATC
GGCCACACCCAGGCGGCCGCGGGCGTGGCGGCCGTGATCAAGATGGTCCAGGCGCTGCGG
CACGACACCCTGCCGCCGACCCTCCACGTGCAGGAACCCACCAAGCAGGTGGACTGGTCC
GCGGGTGCGGTCGAGCTGCTGACCGAAGGCCGGGAGTGGGCCCGCAACGGCCACCCGCGC
CGGGCCGGTGTCTCGTCGTTCGGCATCAGCGGCACCAACGCGCACCTCATCCTGGAAGAG
GCGCCCGCCGACGACACCGCCGAGGCGGACGTGCCCGACGCCGTGGTGCCCGTGGTGATC
TCCGCGCGCAGCACCGGATCCCTGGCGGGCCAGGCCGGACGCCTGGCGGCGTTCCTCGAC
GGAGACGTCCCGCTGACCCGCGTGGCGGGTGCCCTGCTGTCGACCCGGGCGACGCTGACC
GACCGGGCCGTCGTCGTGGCGGGCTCGGCCGAGGAGGCCCGGGCGGGGCTGACCGCGCTG
GCCCGCGGCGAGAGCGCGAGCGGGCTTGTGACCGGTACCGCAGGGATGCCGGGCAAGACG
GTCTGGGTGTTCCCCGGCCAGGGGACGCAGTGGGCGGGCATGGGCCGGGAGCTCCTCGAA
GCGTCCCCGGTGTTCGCCGAGCGCATTGAGGAATGCGCGGCCGCGCTGCAGCCGTGGATC
GACTGGTCGCTGCTGGACGTCCTCCGTGGCGAAGGTGAGCTGGATCGGGTCGACGTGCTG
CAGCCGGCGTGTTTCGCGGTGATGGTGGGGCTGGCCGCCGTCTGGGCCTCGGTCGGCGTC
GTGCCGGACGCGGTCCTGGGCCACTCCCAGGGCGAGATTGCCGCCGCCTGCGTGTCGGGT
GCACTGTCCCTCGAGGACGCAGCCAAGGTCGTCGCGCTGCGCAGCCAGGCGATCGCGGCG
GAGCTGTCGGGCCGCGGGGGCATGGCGTCGATCCAGCTGAGCCACGACGAGGTGGCTGCC
CGGCTCGCGCCGTGGGCGGGCCGCGTCGAGATCGCCGCCGTCAACGGTCCGGCCTCGGTC
GTGATCGCCGGTGACGCCGAAGCGCTCACCGAGGCCGTCGAAGTCCTCGGCGGTCGGCGG
GTGGCGGTGGACTACGCGTCCCACACGCGGCACGTCGAGGACATCCAGGACACCCTCGCC
GAGACTCTGGCCGGGATCGACGCGCAGGCCCCCGTGGTGCCCTTCTACTCCACGGTCGCC
GGCGAGTGGATCACCGATGCCGGGGTCGTCGACGGCGGGTACTGGTACCGGAACCTGCGC
AACCAGGTCGGCTTCGGCCCGGCCGTGGCCGAGCTGATCGAGCAGGGGCACGGGGTGTTC
GTCGAGGTCAGTGCGCATCCGGTGCTGGTGCAGCCGATCAGCGAGCTCACCGATGCGGTC
GTCACCGGGACGTTGCGGCGCGACGACGGTGGGGTGCGGCGGCTGCTGACCTCGATGGCC
GAACTGTTCGTCCGCGGTGTCCCGGTCGACTGGGCCACGATGGCGCCGCCCGCGCGCGTC
GAGCTGCCGACCTACGCCTTCGACCACCAGCACTTCTGGCTCAGCCCGCCCGCCGTGGCG
GACGCGCCCGCGCTCGGCCTGGCCGGCGCCGACCACCCGCTGCTGGGGGCGGTTCTCCCG
CTGCCGCAGTCCGACGGCCTGGTGTTCACCTCGCGCCTGTCGGTGCGGACGCATCCGTGG
CTGGCCGACGGCGTCCCCGCCGCCGCCTTGGTGGAGCTGGCCGTGCGGGCCGGTGACGAA
GCCGGTTGCCCGGTCCTCGCCGACCTGACCGTCGAAAAGCTGCTGGTGCTGCCGGAGAGC
GGTGGCCTGCGCGTCCAGGTGATCGTGAGCGGCGAGCGCACGGTCGAGGTGTATTCGCAG
CTCGAAGGCGCCGAAGACTGGATCCGGAACGCCACCGGGCACCTGTCCGCCACGGCTCCG
GCGCACGAGGCCTTCGACTTCACCGCCTGGCCGCCCGCCGGAGCCCAGCAGGTCGACGGC
CTCTGGCGGCGCGGCGACGAGATCTTCGCCGAGGTCGCCCTGCCGGAGGAGCTGGACGCC
GGCGCGTTCGGCATCCACCCCTTCCTGCTGGACGCGGCCGTGCAGCCGGTCCTCGCGGAC
GACGAGCAGCCGGCGGAGTGGCGCAGCCTGGTCCTGCACGCCGCGGGTGCCTCGGCGCTG
CGCGTGCGGCTGGTGCCCGGCGGTGCCCTCCAAGCGGCGGACGAAACCGGCGGGCTGGTC
CTCACGGCGGATTCGGTGGCAGGCCGGGAACTCTCGGCCGGGAAGACCCGCGCCGGATCG
CTGTACCGGGTCGACTGGACCGAAGTGTCCATTGCAGACAGTGCGGTGCCGGCCAACATC
GAGGTCGTCGAAGCCTTCGGTGAAGAGCCCCTGGAACTGACCGGCCGGGTCCTGGAGGCT
GTGCAGACCTGGCTCGTCACCGCGGCCGACGATGCGCGGCTGGTCGTGGTGACCCGCGGC
GCCGTGCGCGAGGTGACCGACCCCGCCGGTGCGGCCGTGTGGGGCCTGGTCCGAGCCGCG
CAGGCGGAGAACCCCGGTCGCATCTTCCTGATCGACACCGACGGCGAGATCCCGGCCCTG
ACCGGTGACGAGCCCGAGATCGCGGTGCGCGGCGGGAAGTTCTTCGTGCCCCGCATCACT
CGCGCGGAGCCGAGCGGGGCCGCCGTGTTCCGCCCGGACGGGACAGTGCTGATCTCGGGC
GCGGGTGCGCTCGGTGGCCTGGTGGCCCGGCGTCTCGTCGAACGCCACGGCGTGCGGAAG
CTCGTGCTGGCGTCCCGGCGCGGCCGAGACGCCGACGGCGTGGCGGACCTGGTCGCCGAC
CTGGCCGCGGACGTGTCCGTGGTGGCTTGCGACGTCTCCGATCGCGCCCAGGTGGCGGCC
CTGCTCGACGAGCACCGGCCGACCGCCGTCGTGCACACCGCCGGCGTCATCGACGCGGGC
GTGATCGAGACGCTGGACCGGGACCGGCTGGCCACGGTGTTCGCGCCGAAGGTCGACGCC
GTGCGGCACCTCGACGAGCTGACCCGCGACCGCGACCTCGACGCCTTCGTCGTCTACTCC
TCGGTCTCGGCCGTGTTCATGGGCGCGGGCAGCGGCAGTTACGCCGCGGCGAACGCCTTC
CTGGACGGCCTGATGGCGAACCGCCGGGCGGCGGGCCTGCCGGGCCTGTCGCTGGCGTGG
GGCCTGTGGGACCAGAGCACCGGTATGGCCGCCGGCACCGACGAGGCCACCCGGGCGCGG
ATGAGCCGCCGCGGTGGCCTGCAGATCATGACGCAGGCCGAGGGCATGGACCTGTTCGAC
GCCGCGCTGTCGTCGGCCGAGTCGCTGCTGGTGCCCGCCAAGCTCGACCTGCGTGGGGTG
CGCGCCGACGCCGCCGCGGGCGGGGTCGTGCCGCACATGCTGCGTGGCCTGGTCCGCGCG
GGCCGGGCGCAGGCCCGCGCGGCGTCCACTGTGGACAACGGGCTGGCCGGACGGCTGGCC
GGGCTCGCCCCGGCGGACCAGCTCACGCTGCTCCTGGACCTGGTCCGGGCGCAGGTCGCG
GCCGTGCTCGGGCACGCCGACGCGAGCGCCGTCCGCGTCGACACGGCCTTCAAGGACGCC
GGCTTCGACTCGCTGACCGCGGTCGAGCTGCGCAACCGCATGCGGACCGCCACCGGCCTG
AAGCTGCCCGCGACGCTCGTCTTCGACTACCCGAACCCCCAGGCGCTCGCCCGGCACCTG
CGCGACGAACTCGGTGGTGCGGCCCAGACGCCGGTGACCACAGCGGCCGCGAAGGCCGAC
CTCGACGAGCCGATCGCCATCGTCGGGATGGCGTGCCGCTTGCCGGGCGGGGTCGCCGGG
CCCGAGGACCTCTGGCGGCTGGTCGCCGAGGGCCGGGACGCGGTGTCGAGCTTCCCGACC
GACCGCGGCTGGGACACCGACAGCCTGTACGACCCCGATCCGGCCCGCCCGGGCAAGACC
TACACCCGGCACGGCGGCTTCCTGCACGAAGCCGGGCTCTTCGACGCGGGCTTCTTCGGG
ATCTCGCCACGCGAGGCCGTCGCCATGGACCCGCAGCAGCGGCTGCTGCTGGAGGCCTCC
TGGGAGGCCATGGAAGACGCCGGGGTCGACCCACTTTCGCTGAAGGGCAACGACGTCGGC
GTGTTCACCGGCATGTTCGGCCAGGGTTACGTCGCTCCCGGGGACAGCGTCGTCACGCCG
GAGCTGGAGGGTTTCGCGGGCACGGGCGGGTCGTCGAGTGTCGCGTCCGGCCGCGTGTCG
TACGTGTTCGGGTTCGAAGGCCCGGCCGTGACGATCGACTCGGCGTGCTCGTCCTCGCTG
GTCGCGATGCACCTCGCCGCGCAGTCGCTGCGGCAGGGCGAGTGCTCGATGGCCTTGGCC
GGCGGCGCGACGGTGATGGCGAACCCCGGCGCATTCGTGGAGTTCTCGCGGCAGCGGGGC
CTCGCCGTCGACGGTCGCTGCAAGGCGTTCGCCGCCGCGGCCGACGGCACCGGCTGGGCC
GAGGGCGTCGGTGTGGTCATCCTCGAGCGGCTGTCGGTGGCGCGGGAACGCGGCCACCGG
ATCCTGGCCGTGCTGCGCGGCAGCGCGGTCAACCAGGACGGCGCCTCGAACGGCCTGACC
GCGCCGAACGGGCCGTCGCAGCAGCGGGTGATCCGCCGGGCGCTGGTGAGCGCCGGGCTG
GCACCGTCCGATGTGGACGTCGTCGAGGCGCACGGCACCGGGACCACGCTGGGTGACCCG
ATCGAGGCGCAAGCTCTGCTGGCTACCTACGGCAAGGACCGCGAGTCGCCGCTGTGGCTC
GGCTCGCTGAAGTCGAACATCGGCCACGCGCAGGCCGCCGCGGGGGTCGCCGGCGTCATC
AAGATGGTCCAGGCGCTCCGGCACGAAGTCCTGCCGCCGACGCTGCACGTCGACCGGCCT
ACCCCCGAGGTCGACTGGTCGGCCGGTGCCGTCGAACTGCTGACGGAAGCCCGCGAGTGG
CCGCGCAACGGGCGCCCGCGCCGGGCCGGGGTCTCCGCGTTCGGCGTCAGCGGCACGAAC
GCGCACCTGATCCTGGAGGAGGCGCCCGCCGAAGAGCCGGTGCCCACACCCGAGGTTCCC
CTGGTGCCGGTCGTGGTCTCCGCGCGGAGCAGGGCGTCCCTGGCCGGTCAGGCCGGTCGC
CTCGCCGGATTCGTGGCGGGTGACGCGTCCTTGGCCGGTGTGGCCCGGGCGCTGGTGACG
AACCGGGCCGCGCTGACCGAGCGCGCGGTCATGGTCGTGGGCTCTCGCGAAGAAGCCGTG
ACGAACCTGGAAGCGCTGGCCCGCGGCGAAGACCCGGCCGCGGTGGTCACCGGCCGGGCG
GGTTCGCCGGGCAAGCTCGTCTGGGTCTTCCCCGGCCAGGGCTCGCAGTGGATCGGGATG
GGCCGGGAACTCCTGGACTCTTCGCCGGTCTTCGCCGAGCGGGTCGCCGAATGCGCGGCC
GCCCTGGAACCGTGGATCGATTGGTCACTGCTCGACGTGCTGCGCGGGGAGTCCGACCTG
CTGGACCGGGTCGACGTCGTGCAGCCCGCCAGCTTCGCGATGATGGTCGGCCTGGCCGCG
GTGTGGCAGTCGGTGGGTGTCCGCCCGGATGCCGTCGTCGGCCACTCGCAGGGCGAGATC
GCCGCCGCCTGCGTCTCGGGCGCGCTGTCGCTGCAGGACGCCGCGAAGGTGGTTGCCTTG
CGCAGCCAGGCGATCGCCACCCGGCTGGCCGGGCGCGGCGGCATGGCTTCCGTGGCGTTG
AGCGAAGAAGACGCGACCGCGTGGCTGGCGCCGTGGGCCGACCGGGTCCAGGTGGCCGCG
GTCAACAGCCCTGCCTCCGTGGTGATCGCCGGGGAAGCCCAGGCCCTCGACGAGGTCGTC
GACGCGTTGTCCGGTCAGGAAGTCCGCGTCCGGCGGGTGGCCGTGGACTACGGGTCCCAC
ACCAACCAGGTCGAAGCCATCGAGGATCTGCTGGCCGAGACCTTGGCCGGCATCGAGGCG
CAGGCCCCGAAGGTGCCCTTCTACTCGACCCTGATCGGTGACTGGATCCGTGACGCCGGG
ATCGTCGACGGCGGCTACTGGTACCGGAACCTGCGCAACCAGGTCGGGTTCGGTCCGGCC
GTCGCGGAGCTCGTTCGCCAGGGCCACGGGGTGTTCGTCGAGGTCAGCGCGCACCCGGTG
CTGGTCCAGCCGCTCAGTGAACTCAGCGACGACGCGGTGGTGACCGGGTCGCTGCGGCGC
GAAGACGGTGGCCTGCGCCGCCTGCTGACGTCGATGGCCGAGCTGTACGTGCAGGGTGTC
CCGCTCGACTGGACCGCGGTCCTGCCGCGGACCGGCCGGGTCGACCTGCCGAAGTACGCC
TTCGACCACCGGCACTACTGGCTGCGGCCCGCCGAGTCCGCGACCGACGCGGCTTCGCTG
GGCCAGGGGGCGGCCGACCACCCGTTGCTGGGCGCGGTCGTCGAGCTGCCGCAGTCCGAC
GGCCTGGTGTTCACCTCGCGGCTGTCCGTGCGGACGCACCCGTGGCTGGCCGACCACGCG
GTCGGTGGCGTGGTCATCCTCCCCGGCTCCGGGCTGGCCGAACTGGCCGTCCGGGCCGGC
GACGAAGCCGGGTGCACCGCCCTCGACGAGCTGATTATCGAAGCTCCGCTGGTCGTGCCC
GCCCAAGGCGCGGTCCGCGTCCAGGTCGCGTTGAGCGGCCCGGACGAGACCGGCTCGCGC
ACGGTGGACCTCTACTCCCAGCGCGACGGCGGCGCGGGGACGTGGACGCGGCACGCCACC
GGCGTGCCGTCGACGGCCCCCGCTCAGGAACCCGAGTTCGACTTCCACGCCTGGCCGCCC
GCGGATGCCGAGCGGATCGACGTCGAGACCTTCTACACCGACCTGGCCGAGCGTGGTTAC
GGCTACGGGCCGGCGTTCCAGGGGCTGCAAGCGGTGTGGCGGCGCGACGGCGATGTCTTC
GCCGAGGTCGCCCTGCCCGAGGACCTGCGCAAGGACGCGGGCCGGTTCGGCGTCCACCCG
GCGCTGCTCGACGCGGCGCTGCAGGCCGCCACGGCCGTGGGCGGCGACGAGCCCGGTCAG
CCGGTGCTGGCGTTCGCGTGGAACGGCCTGGTCCTGCACGCCGCGGGCGCGTCGGCCCTG
CGGGTCCGGCTCGCGCCGAGCGGCCCGGACACGCTGTCCGTGGCAGCCGCCGACGAAACC
GGCGGCTTGGTCCTGACCATGGAATCGCTGGTCTCCCGGCCGGTTTCGGCCGAGCAGCTC
GGCGCCGCGGCCGACGCGGGCCACGACGCGATGTTCCGCGTCGACTGGACCGAGCTGCCT
GCCGTGCCCCGCGCGGAACTGCCGCCGTGGGTGCGGATCGACACCGCCGACGACGTCGCG
GCCTTGGCGGAGAAGGCGGACGCACCACCGGTGGTGGTCTGGGAAGCCGCCGGGGGAGAC
CCGGCCCTGGCCGTGAGTTCCCGGGTGCTCGAGATCATGCAGGCCTGGCTGGCCGCGCCC
GCGTTCGAGGAGGCCCGGCTGGTCGTGACGACCCGCGGCGCGGTACCCGCCGGCGGTGAC
CACACACTGACCGACCCGGCCGCGGCCGCGGTGTGGGGCCTGGTCCGGTCCGCGCAGGCG
GAACACCCGGACCGGGTCGTCCTGCTGGACACCGACGGCGAAGTTCCGCTGGGCGCGGTG
CTGGCCTCCGGTGAGCCGCAGCTCGCGGTGCGCGGAACGACGTTCTTCGTGCCCCGGCTG
GCCCGCGCCACCCGGCTCTCGGACGCGCCTCCTGCGTTCGACCCGGACGGGACCGTGCTG
GTCTCGGGCGCCGGATCGCTGGGCACCTTGGTGGCCCGGCACCTGGTCACCCGGCACGGC
GTGCGCCGGGTGGTGCTGGCCAGCCGGCAGGGCCGGGACGCCGAGGGCGCCCAGGACCTG
ATCACCGAGCTCACCGGCGAAGGCGCGGACGTGTCCTTCGTGGCCTGTGACGTCTCCGAT
CGCGACCAGGTGGCCGCGCTGCTCGCGGGCCTCCCGGACCTGACCGGGGTGGTGCACACC
GCCGGCGTCTTCGAGGACGGCGTGATCGAGGCGCTGACGCCCGACCAGCTCGCGAACGTG
TACGCGGCCAAGGTCACGGCCGCGATGCACCTCGACGAGCTCACCCGCGACCGGGATCTC
GGCGCGTTCGTCGTGTTCTCCTCCGTCGCGGGGGTGATGGGTGGTGGCGGTCAAGGCCCG
TACGCGGCGGCGAACGCCTTCCTGGACGCGGCGATGGCGAGTCGTCAGGCCGCGGGCCTG
CCGGGCCTGTCCCTGGCGTGGGGCCTCTGGGAACGCAGCAGCGGCATGGCCGCCCACCTC
AGCGAGGTCGACCACGCGCGGGCGAGCCGCAACGGTGTCCTGGAACTGACCCGGGCCGAG
GGCCTGGCGCTGTTCGACCTCGGGCTGCGGATGGCCGAGTCGCTGCTCGTGCCGATCAAG
CTCGACCTCGCCGCGATGCGGGCGAGCACGGTCCCGGTCCTGTTCCGCGGCCTGGTCCGG
CCGAGCCGGACCCAGGCGCGCACGGCGTCCACTGTGGACCGGGGGCTGGCCGGGCGGCTC
GCCGGGCTGCCGGTGGCCGAGCGGGCGGCGGTGCTGGTCGACCTGGTGCGCGGGCAGGTC
GCGGTCGTGCTCGGCTACGACGGGCCGGAGGCCGTCCGCCCGGACACGGCGTTCAAGGAC
ACCGGGTTCGACTCGCTGACGTCGGTGGAACTGCGCAACCGGCTGCGCGAGGCGACCGGG
CTCAAGCTCCCCGCCACGCTCGTCTTCGACTACCCGAACCCCTTGGCGGTGGCGCGCTAC
CTGGGCGCGCGGCTGGTCCCGGACGGGACCGCGAACGGCAACGGGAACGGGAATGGGCAC
AGCGAAGACGACCGGCTGCGGCACGCGCTGGCGGCCATCGCGGCCGAGGACGCGGGCGAG
GAGCGGTCGATCGCCGACCTGGGCGTCGACGACCTCGTGCAACTGGCTTTCGGCGACGAG
TGA
[4] KS35..411
[4] AT561..877
[4] methylmalonyl-CoA751..755
[4] DH923..1085
[4] KR1346..1519
[4] ACP1624..1694
[5] KS1717..2090
[5] AT2241..2548
[5] methylmalonyl-CoA2425..2429
[5] dh2592..2726
[5] KR2954..3126
[5] ACP3231..3301
[6] KS3322..3698
[6] AT3847..4160
[6] methylmalonyl-CoA4037..4041
[6] dh4207..4369
[6] KR4657..4833
[6] ACP4932..5002
[4] KS103..1233
[4] AT1681..2631
[4] methylmalonyl-CoA2251..2265
[4] DH2767..3255
[4] KR4036..4557
[4] ACP4870..5082
[5] KS5149..6270
[5] AT6721..7644
[5] methylmalonyl-CoA7273..7287
[5] dh7774..8178
[5] KR8860..9378
[5] ACP9691..9903
[6] KS9964..11094
[6] AT11539..12480
[6] methylmalonyl-CoA12109..12123
[6] dh12619..13107
[6] KR13969..14499
[6] ACP14794..15006

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [557-682]  G3DSA:3.40.366.10 [751-866]  G3DSA:3.40.366.10 [2234-2361]  G3DSA:3.40.366.10 [2425-2537]  G3DSA:3.40.366.10 [3837-3968]  G3DSA:3.40.366.10 [4037-4150]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [1346-1506]  1.9e-53 PF00106 [4657-4820]  1.40000000000001e-54 PF00106
PF00106   adh_short
IPR006162 Phosphopantetheine attachment site (PTM)
 [1652-1667]  PS00012 [3259-3274]  PS00012 [4960-4975]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1628-1693]  1.5e-11 PF00550 [3234-3300]  4.5e-13 PF00550 [4936-5001]  1.4e-11 PF00550
PF00550   PP-binding
 [1617-1733]  2.70000183580794e-27 SSF47336 [3224-3339]  4.80000830876748e-30 SSF47336 [4923-5009]  1.89999859865865e-22 SSF47336
SSF47336   ACP_like
 [1624-1694]  PS50075 [3231-3301]  PS50075 [4932-5002]  PS50075
PS50075   ACP_DOMAIN
 [1627-1699]  2.50000000000001e-67 G3DSA:1.10.1200.10 [3231-3306]  2.50000000000001e-67 G3DSA:1.10.1200.10 [4932-5005]  2.50000000000001e-67 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR013968 Polyketide synthase, KR (Domain)
 [2954-3125]  4.5e-48 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [35-284]  1.79999999999997e-89 PF00109 [1717-1966]  8.80000000000003e-94 PF00109 [3322-3573]  1.79999999999997e-95 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [293-411]  1.70000000000001e-46 PF02801 [1975-2090]  9.8e-49 PF02801 [3582-3698]  4.6e-49 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [561-877]  1.39999999999997e-103 PF00698 [2241-2548]  4.59999999999996e-97 PF00698 [3847-4160]  7.79999999999999e-102 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [559-861]  7.49999605851445e-68 SSF52151 [2239-2535]  3.19999899046355e-65 SSF52151 [3845-4131]  1.70000295590053e-62 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [685-750]  4.60000044330862e-20 SSF55048 [2364-2424]  3.39999972437717e-15 SSF55048 [3971-4036]  1.20000117458134e-18 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [37-297]  G3DSA:3.40.47.10 [298-464]  G3DSA:3.40.47.10 [1719-1979]  G3DSA:3.40.47.10 [1980-2143]  G3DSA:3.40.47.10 [3325-3586]  G3DSA:3.40.47.10 [3587-3751]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [27-463]  2.2999842048857e-101 SSF53901 [1709-2089]  1.59998835313644e-101 SSF53901 [3315-3696]  6.4999795054176e-101 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1346-1525]  2.79999999999994e-93 G3DSA:3.40.50.720 [2955-3134]  2.79999999999994e-93 G3DSA:3.40.50.720 [4658-4838]  2.79999999999994e-93 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [1880-1896]  PS00606 [3487-3503]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [563-858]  5.20000089003336e-122 SM00827 [2243-2529]  1.39999277195148e-113 SM00827 [3849-4142]  4.89996723796399e-112 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1625-1697]  5.50001754266469e-33 SM00823 [3232-3304]  4.39999001237725e-36 SM00823 [4933-5005]  3.49999466863949e-36 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [923-1085]  9.20006495413779e-82 SM00826 [2592-2726]  1.90000694315261e-50 SM00826 [4207-4369]  1.79999754022378e-84 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [37-463]  SM00825 [1719-2143]  SM00825 [3325-3750]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1346-1519]  1.60000240695997e-51 SM00822 [2954-3126]  2.69998997787809e-43 SM00822 [4657-4833]  3.1999989904635e-46 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit