close all open/close all

CDS information : Rifam_00250


close this sectionLocation

Organism
StrainS699
Entry nameRifamycin
Contig
Start / Stop / Direction57,778 / 68,019 / + [in whole cluster]
57,778 / 68,019 / + [in contig]
Location57778..68019 [in whole cluster]
57778..68019 [in contig]
TypeCDS
Length10,242 bp (3,413 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)RifE
Gene
Gene (GenBank)rifE
EC number
Keyword
Note
Note (GenBank)
  • rifamycin polyketide synthase
Reference
ACC
PmId
[9512878] Biosynthesis of the ansamycin antibiotic rifamycin: deductions from the molecular analysis of the rif biosynthetic gene cluster of Amycolatopsis mediterranei S699. (Chem Biol. , 1998)
[10430893] Direct evidence that the rifamycin polyketide synthase assembles polyketide chains processively. (Proc Natl Acad Sci U S A. , 1999)
[23659177] Stereochemistry of reductions catalyzed by methyl-epimerizing ketoreductase domains of polyketide synthases. (J Am Chem Soc. , 2013)
[24274103] Structure and Stereospecificity of the Dehydratase Domain from the Terminal Module of the Rifamycin Polyketide Synthase. (Biochemistry. , 2013)

close this sectionPKS/NRPS Module

9 malonyl-CoA
10 methylmalonyl-CoA
KS31..402
AT554..872
DH918..1081
KR1338..1513
ACP1610..1680
KS1702..2076
AT2228..2541
DH2585..2748
KR3054..3230
ACP3336..3406

close this sectionSequence

selected fasta
>polyketide synthase [RifE]
MATDEKLLKYLKRVTAELHSLRKQGARHADEPLAVVGMACRFPGGVSSPEDLWQLVAGGV
DALSDFPDDRGWELDGLFDPDPDHPGTSYTSQGGFLRGAGLFDAGLFGISPREALVMDPQ
QRVLLETSWEALEDAGVDPLSLKGSDVGVFSGVFTQGYGAGAITPDLEAFAGIGAASSVA
SGRVSYVFGLEGPAVTIDTACSSSLVAIHLAAQALRAGECSMALAGGATVMPTPGTFVAF
SRQRVLAADGRSKAFSSTADGTGWAEGAGVLVLERLSVAQERGHRILAVLRGSAVNQDGA
SNGLTAPNGPSQQRVIRKALAGAGLVASDVDVVEAHGTGTALGDPIEAQALLATYGQGRE
RPLWLGSVKSNFGHTQAAAGVAGVIKMVQALRHGAMPPTLHVAEPTPEVDWSAGAVELLT
EPREWPAGDRPRRAGVSAFGISGTNAHLILEEAPPADAVAEEPEFKGPVPLVVSAGSPTS
LAAQAGRLAEVLASGGVSRARLASGLLSGRALLGDRAVVVAGTDEDAVAGLRALARGDRA
PGVLTGSAKHGKVVYVFPGQGSQRLGMGRELYDRYPVFATAFDEACEQLDVCLAGRAGHR
VRDVVLGEVPAETGLLNQTVFTQAGLFAVESALFRLAESWGVRPDVVLGHSIGEITAAYA
AGVFSLPDAARIVAARGRLMQALAPGGAMVAVAASEAEVAELLGDGVELAAVNGPSAVVL
SGDADAVVAAAARMRERGHKTKQLKVSHAFHSARMAPMLAEFAAELAGVTWREPEIPVVS
NVTGRFAEPGELTEPGYWAEHVRRPVRFAEGVAAATESGGSLFVELGPGAALTALVEETA
EVTCVAALRDDRPEVTALITAVAELFVRGVAVDWPALLPPVTGFVDLPKYAFDQQHYWLQ
PAAQATDAASLGQVAADHPLLGAVVRLPQSDGLVFTSRLSLKSHPWLADHVIGGVVLVAG
TGLVELAVRAGDEAGCPVLEELVIEAPLVVPDHGGVRIQVVVGAPGETGSRAVEVYSLRE
DAGAEVWARHATGFLAATPSQHKPFDFTAWPPPGVERVDVEDFYDGLVDRGYAYGPSFRG
LRAVWRRGDEVFAEVALAEDDRADAARFGIHPGLLDAALHAGMAGATTTEEPGRPVLPFA
WNGLVLHAAGASALRVRLAPSGPDALSVEAADEAGGLVVTADSLVSRPVSAEQLGAAANH
DALFRVEWTEISSAGDVPADHVEVLEAVGEDPLELTGRVLEAVQTWLADAADDARLVVVT
RGAVHEVTDPAGAAVWGLIRAAQAENPDRIVLLDTDGEVPLGRVLATGEPQTAVRGATLF
APRLARAEAAEAPAVTGGTVLISGAGSLGALTARHLVARHGVRRLVLVSRRGPDADGMAE
LTAELIAQGAEVAVVACDLADRDQVRVLLAEHRPNAVVHTAGVLDDGVFESLTRERLAKV
FAPKVTAANHLDELTRELDLRAFVVFSSASGVFGSAGQGNYAAANAYLDAVVANRRAAGL
PGTSLAWGLWEQTDGMTAHLGDADQARASRGGVLAISPAEGMELFDAAPDGLVVPVKLDL
RKTRAGGTVPHLLRGLVRPGRQQARPASTVDNGLAGRLAGLAPAEQEALLLDVVRTQVAL
VLGHAGPEAVRADTAFKDTGFDSLTSVELRNRLREASGLKLPATLVFDYPTPVALARYLR
DELGDTVATTPVATAAAADAGEPIAIVGMACRLPGGVTDPEGLWRLVRDGLEGLSPFPED
RGWDLENLFDDDPDRSGTTYTSRGGFLDGAGLFDAGFFGISPREALAMDPQQRLLLEAAW
EALEGTGVDPGSLKGADVGVFAGVSNQGYGMGADPAELAGYASTAGASSVVSGRVSYVFG
FEGPAVTIDTACSSSLVAMHLAGQALRQGECSMALAGGVTVMGTPGTFVEFAKQRGLAGD
GRCKAYAEGADGTGWAEGVGVVVLERLSVARERGHRVLAVLRGSAVNSDGASNGLTAPNG
PSQQRVIRRALAGAGLEPSDVDIVEGHGTGTALGDPIEAQALLATYGKDRDPETPLWLGS
VKSNFGHTQSAAGVAGVIKMVQALRHGVMPPTLHVDRPTSQVDWSAGAVEVLTEAREWPR
NGRPRRAGVSSFGISGTNAHLIIEEAPAEPQLAGPPPDGGVVPLVVSARSPGALAGQARR
LATFLGDGPLSDVAGALTSRALFGERAVVVADSAEEARAGLGALARGEDAPGLVRGRVPA
SGLPGKLVWVFPGQGTQWVGMGRELLEESPVFAERIAECAAALEPWIGWSLFDVLRGDGD
LDRVDVLQPACFAVMVGLAAVWSSAGVVPDAVLGHSQGEIAAACVSGALSLEDAAKVVAL
RSQAIAAKLSGRGGMASVALGEADVVSRLADGVEVAAVNGPASVVIAGDAQALDETLEAL
SGAGIRARRVAVDYASHTRHVEDIEDTLAEALAGIDARAPLVPFLSTLTGEWIRDEGVVD
GGYWYRNLRGRVRFGPAVEALLAQGHGVFVELSAHPVLVQPITELTDETAAVVTGSLRRD
DGGLRRLLTSMAELFVRGVEVDWTSLVPPARADLPTYAFDHEHYWLRAADTASDAVSLGL
AGADHPLLGAVVQLPQSDGLVFTSRLSLRSHPWLADHAVRDVVIVPGTGLVELAVRAGDE
AGCPVLDELVIEAPLVVPRRGGVRVQVALGGPADDGSRTVDVFSLREDADSWLRHATGVL
VPENRPRGTAAFDFAAWPPPEAKPVDLTGAYDVLADVGYGYGPTFRAVRAVWRRGSGNTT
ETFAEIALPEDARAEAGRFGIHPALLDAALHSTMVSAAADTESYGDEVRLPFAWNGLRLH
AAGASVLRVRVAKPERDSLSLEAVDESGGLVVTLDSLVGRPVSNDQLTTAAGPAGAGSLY
RVDWTPLSSVDTSGRVPSWLPVATAEEVATLADDVLTGATEAPAVAVMEAVADEGSVLAL
TVRVLDVVQCWLAGGGLEGTKLAIVTRGAVPAGDGVVHDPAAAAVWGLVRAAQAENPDRI
VLLDVEPEADVPPLLGSVLADGEPQVAVRGTTLSIPRLARAARPDPAAGFKTRGPVLVTG
GTGSLGGLVARHLVERHGVRQLVLASRRGLDAEGAKDLVTDLTALGADVAVAACDVADRD
QVAALLTEHRPSAVVHTAGVPDAGVIGTVTPDRLAEVFAPKVTAARHLDELTRDLDLDSF
VVYSSVSAVFMGAGSGSYAAANAYLDGLMAHRRAAGLPGQSLAWGLWDQTTGGMAAGTDE
AGRARMTRRGGLVAMKPAAGLDLFDAAIGSGEPLLVPAQLDLRGLRAEAAGGTEVPHLLR
GLVRAGRQQARAASTVEENWAGRLAGLEPAERGQVLLELVRAQVAGVLGYRAAHQVDPDQ
GLFEIGFDSLTAIELRNRLRARTERKISPGVVFDHPTPALLAAHLNELLRKKV
selected fasta
>polyketide synthase [RifE]
ATGGCCACGGACGAGAAACTCCTCAAATACCTCAAGCGCGTCACGGCGGAGCTGCACAGC
CTGCGCAAGCAGGGTGCCCGGCACGCCGACGAGCCGCTCGCCGTCGTCGGGATGGCCTGC
CGGTTCCCGGGTGGGGTGTCCTCGCCCGAAGACCTGTGGCAGCTCGTGGCCGGCGGGGTC
GACGCCCTTTCGGACTTCCCCGACGACCGGGGCTGGGAGCTGGACGGCCTGTTCGACCCG
GACCCCGACCACCCCGGGACGTCGTACACCAGCCAGGGCGGCTTCCTGCGTGGCGCCGGG
CTGTTCGACGCGGGCCTGTTCGGCATCTCGCCGCGCGAGGCCCTCGTCATGGACCCGCAG
CAGCGGGTGCTGCTGGAGACGTCGTGGGAGGCCCTCGAAGACGCCGGGGTCGACCCGCTT
TCGCTGAAGGGCAGCGACGTCGGCGTGTTCTCCGGCGTCTTCACCCAGGGCTACGGCGCC
GGGGCGATCACGCCGGACCTCGAGGCGTTCGCGGGCATCGGGGCGGCGTCGAGCGTGGCG
TCGGGCCGGGTGTCCTACGTCTTCGGGCTCGAAGGACCGGCGGTCACCATCGACACCGCG
TGTTCGTCGTCGCTGGTGGCCATCCACCTCGCCGCGCAGGCCCTGCGCGCGGGCGAGTGC
TCGATGGCGCTCGCCGGCGGGGCGACGGTGATGCCGACGCCCGGCACCTTCGTCGCGTTC
TCGCGGCAGCGGGTGCTGGCTGCCGACGGCCGGTCCAAGGCCTTCTCCTCGACCGCGGAC
GGCACCGGCTGGGCCGAGGGCGCCGGGGTGCTCGTCCTCGAACGGCTTTCGGTCGCGCAG
GAGCGCGGCCACCGGATTCTCGCCGTGCTGCGCGGCAGCGCGGTCAACCAGGATGGCGCC
TCCAACGGCCTGACCGCGCCGAACGGGCCTTCGCAGCAGCGGGTGATCCGCAAGGCGCTC
GCGGGCGCCGGGCTGGTCGCGTCCGATGTGGACGTCGTGGAGGCGCACGGCACGGGCACC
GCGCTGGGCGACCCGATCGAAGCGCAGGCGCTGCTGGCGACCTACGGCCAGGGCCGTGAG
CGGCCGCTGTGGCTGGGGTCGGTCAAGTCGAACTTCGGGCACACGCAGGCGGCCGCCGGG
GTCGCGGGCGTGATCAAGATGGTCCAGGCCCTGCGGCACGGCGCCATGCCGCCGACCCTG
CACGTGGCCGAGCCGACGCCGGAGGTCGACTGGTCGGCCGGTGCGGTGGAACTGCTGACC
GAGCCGCGCGAGTGGCCCGCCGGTGATCGGCCGCGCCGGGCCGGGGTGTCCGCGTTCGGG
ATCAGCGGGACGAACGCCCACCTGATCCTGGAGGAGGCGCCCCCGGCCGACGCGGTCGCG
GAAGAACCGGAGTTCAAGGGGCCGGTGCCGCTGGTCGTCTCGGCGGGCAGCCCCACATCT
TTGGCGGCTCAGGCCGGCCGGCTCGCGGAGGTCCTGGCGTCCGGTGGTGTGTCCCGGGCC
CGGCTGGCGAGCGGGCTGCTGTCGGGCCGGGCGCTGCTCGGTGACCGCGCGGTCGTGGTC
GCGGGAACGGACGAGGACGCGGTGGCCGGGTTGCGTGCGCTGGCCCGCGGGGACCGCGCG
CCCGGCGTGCTGACCGGTTCGGCCAAGCACGGCAAGGTCGTCTACGTCTTCCCCGGCCAG
GGTTCGCAGCGGCTCGGGATGGGCCGCGAGCTCTACGACCGGTACCCGGTGTTCGCGACG
GCGTTCGACGAGGCTTGCGAGCAGCTGGACGTCTGTCTGGCCGGCCGTGCCGGGCACCGC
GTGCGGGACGTCGTGCTCGGCGAAGTGCCCGCCGAAACCGGGCTGCTGAACCAGACGGTC
TTCACCCAAGCCGGGCTGTTCGCGGTGGAGAGCGCGCTGTTCCGGCTCGCCGAATCCTGG
GGTGTCCGGCCGGACGTGGTGCTCGGCCACTCCATCGGGGAGATCACCGCCGCGTATGCC
GCGGGCGTCTTCTCGCTGCCGGACGCCGCCCGGATCGTCGCGGCGCGCGGCCGGCTGATG
CAGGCGCTGGCGCCGGGCGGGGCGATGGTCGCCGTCGCCGCCTCCGAAGCCGAGGTGGCC
GAACTGCTCGGCGACGGCGTGGAACTCGCCGCCGTCAACGGCCCTTCGGCGGTAGTCCTT
TCCGGGGACGCGGACGCGGTCGTCGCGGCCGCCGCCCGCATGCGCGAGCGCGGGCACAAG
ACCAAGCAGCTCAAGGTTTCGCACGCGTTCCACTCCGCGCGGATGGCGCCGATGCTGGCG
GAGTTCGCCGCCGAGCTGGCCGGCGTGACGTGGCGCGAGCCGGAGATCCCGGTGGTCTCC
AACGTGACCGGCCGGTTCGCCGAGCCCGGCGAACTGACCGAGCCGGGCTACTGGGCCGAG
CACGTGCGGCGGCCGGTGCGGTTCGCCGAGGGCGTCGCGGCCGCGACGGAGTCCGGCGGC
TCGCTGTTCGTGGAGCTCGGGCCGGGGGCGGCGCTGACCGCCCTCGTCGAGGAGACGGCC
GAGGTCACCTGCGTCGCGGCCCTGCGGGACGACCGCCCGGAGGTCACCGCGCTGATCACC
GCGGTCGCCGAGCTGTTCGTCCGCGGGGTTGCGGTCGATTGGCCGGCCCTGCTGCCGCCG
GTCACCGGGTTCGTCGACCTGCCGAAGTACGCCTTCGACCAGCAGCACTATTGGCTGCAG
CCCGCCGCGCAGGCCACGGACGCGGCCTCGCTCGGGCAGGTCGCGGCCGACCACCCGCTG
CTGGGCGCGGTGGTCCGGCTGCCGCAGTCGGACGGCCTGGTCTTCACCTCGCGGCTGTCA
TTGAAATCGCACCCGTGGCTGGCCGACCACGTCATCGGCGGGGTGGTGCTCGTCGCGGGC
ACCGGGCTCGTCGAGCTGGCCGTCCGGGCCGGGGACGAGGCCGGCTGCCCGGTCCTCGAA
GAACTCGTCATCGAGGCTCCGCTGGTCGTCCCCGACCACGGCGGGGTCCGGATCCAGGTC
GTCGTGGGGGCACCGGGGGAGACCGGTTCGCGCGCGGTCGAGGTGTACTCCCTGCGCGAG
GACGCCGGTGCCGAAGTGTGGGCCCGGCACGCCACCGGGTTCCTGGCTGCGACGCCGTCG
CAGCACAAGCCGTTCGACTTCACCGCCTGGCCGCCGCCCGGCGTCGAGCGCGTCGACGTC
GAGGACTTCTACGACGGCCTCGTCGACCGCGGGTACGCCTACGGGCCGTCGTTCCGGGGC
CTGCGGGCGGTGTGGCGGCGCGGCGACGAAGTGTTCGCCGAGGTCGCCCTGGCCGAGGAC
GACCGCGCGGACGCGGCCCGGTTCGGCATCCACCCCGGCCTGCTGGACGCCGCCCTGCAC
GCGGGCATGGCCGGTGCCACCACCACGGAAGAGCCCGGCCGGCCGGTGCTGCCGTTCGCC
TGGAACGGCCTGGTGCTGCACGCGGCCGGGGCGTCCGCGCTGCGGGTCCGGCTCGCCCCG
AGCGGTCCGGACGCCCTGTCGGTCGAGGCCGCGGACGAGGCCGGCGGTCTCGTTGTGACG
GCGGACTCGCTGGTCTCCCGGCCGGTGTCGGCCGAACAGCTGGGCGCGGCGGCGAACCAC
GACGCGTTGTTCCGCGTGGAGTGGACCGAGATTTCCTCGGCTGGAGACGTTCCGGCGGAC
CACGTCGAAGTGCTCGAAGCCGTCGGCGAGGATCCCCTGGAACTGACCGGCCGGGTCCTG
GAGGCCGTGCAGACCTGGCTCGCCGACGCAGCCGACGACGCTCGCCTGGTCGTGGTGACC
CGCGGCGCCGTCCACGAGGTGACTGACCCGGCCGGTGCCGCGGTGTGGGGCCTGATCCGG
GCCGCGCAGGCGGAAAACCCGGACCGGATCGTGCTGCTGGACACCGACGGTGAAGTGCCG
CTAGGCCGGGTGCTGGCCACCGGCGAGCCCCAAACAGCCGTCCGAGGCGCCACGCTGTTC
GCCCCGCGGCTGGCCCGCGCCGAGGCCGCGGAGGCACCGGCAGTGACCGGCGGGACGGTC
CTGATCTCGGGCGCCGGCTCGCTGGGCGCGCTCACCGCCCGGCACCTGGTCGCCCGGCAC
GGAGTCCGGCGGCTGGTGCTCGTCAGCCGCCGTGGCCCCGACGCCGACGGCATGGCCGAA
CTGACCGCTGAACTCATCGCTCAGGGCGCCGAGGTCGCCGTAGTCGCTTGCGACCTGGCC
GACCGGGACCAGGTCCGGGTACTGCTGGCCGAGCACCGCCCGAACGCCGTCGTGCACACG
GCCGGTGTTCTCGACGACGGCGTCTTCGAGTCGCTGACGCGGGAGCGGCTGGCCAAGGTC
TTCGCGCCCAAAGTTACTGCTGCCAATCACCTCGACGAGCTGACCCGCGAACTGGATCTT
CGCGCGTTCGTCGTGTTCTCCTCCGCCTCCGGGGTCTTCGGCTCCGCCGGGCAGGGCAAC
TACGCCGCTGCCAACGCCTACCTGGACGCCGTGGTCGCCAACCGCCGGGCCGCGGGCCTG
CCCGGCACATCGCTGGCCTGGGGCCTGTGGGAACAGACCGACGGGATGACCGCGCACCTC
GGCGACGCCGACCAGGCGCGGGCGAGTCGCGGCGGGGTCCTCGCCATCTCACCCGCCGAA
GGCATGGAGCTGTTCGACGCAGCGCCGGACGGGCTCGTCGTCCCGGTCAAGCTGGACCTG
CGCAAGACCCGCGCCGGCGGGACGGTGCCGCACCTGCTGCGCGGCCTGGTCCGCCCGGGA
CGGCAGCAGGCCCGTCCGGCGTCCACTGTGGACAACGGACTGGCCGGGCGACTCGCCGGG
CTCGCGCCGGCGGAGCAGGAGGCGCTGCTGCTCGACGTCGTCCGCACGCAGGTCGCGCTG
GTGCTCGGGCACGCCGGGCCGGAGGCCGTCCGCGCGGACACGGCGTTCAAGGACACCGGC
TTCGACTCGCTGACGTCGGTGGAACTGCGCAACCGGCTGCGCGAGGCGAGCGGGCTGAAG
CTGCCCGCGACGCTCGTCTTCGACTACCCGACGCCGGTCGCGCTGGCCCGCTACCTGCGT
GACGAACTCGGCGACACGGTGGCAACAACTCCGGTGGCCACCGCGGCCGCAGCGGACGCC
GGCGAGCCGATCGCCATCGTCGGCATGGCGTGCCGGCTGCCGGGCGGGGTCACCGATCCC
GAAGGCCTGTGGCGCCTGGTGCGCGACGGCCTCGAAGGGCTGTCTCCCTTCCCCGAGGAC
CGGGGCTGGGACCTGGAGAACCTGTTCGACGACGACCCCGACCGCTCCGGCACGACGTAC
ACCAGCCGGGGCGGGTTCCTCGACGGCGCCGGCCTGTTCGACGCGGGCTTCTTCGGGATT
TCGCCGCGCGAGGCGCTGGCCATGGACCCGCAGCAGCGGCTGCTGCTCGAGGCGGCCTGG
GAAGCCCTCGAAGGCACCGGTGTCGACCCGGGCTCGTTGAAGGGCGCCGACGTCGGGGTG
TTCGCCGGGGTGTCCAACCAGGGCTATGGGATGGGCGCGGATCCGGCCGAACTGGCGGGG
TACGCGAGCACGGCGGGCGCTTCGAGCGTCGTCTCGGGCCGAGTCTCGTACGTCTTCGGG
TTCGAAGGACCGGCGGTCACGATCGACACGGCTTGCTCGTCGTCGCTGGTGGCGATGCAC
CTGGCCGGGCAGGCGCTGCGGCAGGGCGAGTGCTCGATGGCCCTGGCCGGTGGCGTCACG
GTGATGGGGACGCCCGGCACGTTCGTGGAGTTCGCGAAGCAGCGCGGCCTGGCCGGCGAC
GGCCGGTGCAAGGCCTACGCCGAAGGCGCGGACGGCACGGGCTGGGCCGAGGGCGTCGGG
GTCGTCGTGCTGGAGCGGCTGTCGGTGGCGCGCGAGCGCGGGCACCGGGTGCTGGCCGTG
CTGCGCGGCAGCGCGGTCAACTCCGACGGCGCGTCCAACGGCCTGACCGCCCCCAACGGG
CCGTCGCAGCAACGGGTGATCCGCCGGGCCCTGGCCGGCGCCGGCCTCGAACCGTCCGAT
GTGGACATCGTGGAAGGGCACGGCACCGGGACGGCGCTGGGCGACCCGATCGAGGCGCAG
GCCCTGCTGGCCACCTACGGCAAGGACCGCGACCCGGAGACGCCGTTGTGGCTGGGGTCG
GTGAAGTCGAACTTCGGCCACACGCAGTCCGCGGCCGGCGTGGCCGGGGTGATCAAGATG
GTGCAGGCGCTGCGCCACGGCGTCATGCCGCCCACCCTGCACGTGGACCGGCCCACCAGC
CAGGTCGACTGGTCCGCGGGGGCCGTCGAAGTGCTGACCGAGGCACGGGAGTGGCCGCGG
AACGGCCGTCCGCGCCGGGCCGGGGTGTCCTCGTTCGGGATCAGCGGCACGAACGCCCAC
CTGATCATCGAAGAAGCACCGGCCGAGCCACAGCTTGCCGGACCACCGCCGGACGGCGGT
GTGGTGCCGCTGGTCGTCTCGGCTCGCAGCCCCGGTGCCCTGGCCGGTCAGGCGCGTCGG
CTGGCCACGTTCCTCGGCGACGGGCCCCTTTCCGACGTCGCCGGTGCGCTGACGAGCCGC
GCCCTGTTCGGCGAGCGCGCGGTCGTCGTGGCGGATTCGGCCGAGGAAGCCCGCGCCGGT
CTGGGCGCACTGGCCCGCGGCGAAGACGCGCCGGGCCTGGTCCGCGGCCGGGTGCCCGCG
TCCGGCCTGCCGGGCAAGCTCGTGTGGGTGTTCCCCGGGCAGGGGACGCAGTGGGTGGGC
ATGGGCCGCGAACTCCTCGAAGAGTCTCCGGTGTTCGCCGAGCGGATCGCCGAGTGTGCG
GCCGCGCTGGAGCCGTGGATCGGCTGGTCGCTGTTCGACGTCCTCCGTGGCGACGGTGAC
CTCGATCGGGTCGATGTGCTGCAGCCCGCGTGCTTTGCGGTGATGGTCGGCTTGGCCGCG
GTGTGGTCCTCGGCCGGGGTGGTCCCCGATGCGGTGCTCGGCCACTCCCAGGGTGAGATC
GCCGCGGCGTGCGTGTCGGGTGCGTTGTCGCTGGAGGATGCGGCGAAGGTGGTTGCCCTG
CGCAGCCAGGCCATCGCCGCGAAGCTCTCCGGCCGCGGCGGGATGGCTTCGGTCGCCTTG
GGCGAAGCCGATGTGGTGTCGCGGCTGGCGGACGGGGTCGAGGTGGCTGCCGTCAACGGT
CCGGCGTCCGTGGTGATCGCGGGGGATGCCCAGGCCCTCGACGAAACGCTGGAAGCGCTG
TCCGGTGCGGGAATCCGGGCTCGGCGGGTGGCGGTGGACTACGCCTCGCACACCCGGCAC
GTCGAAGACATCGAAGACACCCTCGCCGAAGCGCTGGCCGGGATCGACGCCCGGGCGCCG
CTGGTGCCGTTCCTCTCCACCCTCACCGGCGAGTGGATCCGGGACGAGGGCGTCGTGGAC
GGCGGCTACTGGTACCGGAACCTGCGCGGCCGGGTGCGGTTCGGCCCGGCCGTCGAGGCG
CTGCTGGCCCAGGGGCACGGTGTGTTCGTCGAGCTCAGCGCCCACCCGGTGCTGGTCCAG
CCGATCACCGAGCTCACCGACGAAACCGCCGCCGTCGTCACCGGTTCGCTGCGCCGGGAC
GACGGTGGCCTGCGCCGGCTGCTGACCTCGATGGCCGAGCTCTTCGTCCGTGGGGTCGAA
GTGGACTGGACGTCGCTGGTGCCGCCGGCCCGGGCCGACCTCCCGACGTACGCCTTCGAC
CACGAGCACTACTGGCTCCGCGCCGCGGACACCGCTTCCGACGCCGTCTCGCTGGGGCTG
GCCGGGGCGGACCACCCGCTGCTCGGCGCGGTCGTGCAGCTTCCGCAGTCCGACGGCCTG
GTCTTCACTTCCCGGCTCTCCCTGCGCTCGCACCCCTGGCTGGCCGACCACGCGGTCCGG
GACGTCGTGATCGTCCCCGGCACCGGGCTGGTCGAGCTGGCCGTGCGGGCCGGTGACGAA
GCCGGCTGCCCGGTGCTCGACGAGCTGGTGATCGAGGCGCCGCTCGTGGTGCCCCGCCGC
GGCGGGGTCCGCGTGCAGGTCGCCCTCGGCGGCCCCGCCGACGACGGTTCGCGCACGGTG
GACGTCTTCTCCCTGCGCGAAGACGCGGACAGCTGGCTCCGGCACGCCACGGGCGTGCTG
GTCCCGGAGAACCGGCCGCGGGGGACCGCCGCGTTCGACTTCGCCGCCTGGCCGCCACCG
GAGGCGAAGCCCGTGGACCTCACCGGTGCCTACGACGTGCTCGCGGACGTCGGGTACGGC
TACGGGCCCACGTTCCGGGCCGTGCGGGCCGTGTGGCGGCGCGGCAGCGGGAACACCACC
GAGACCTTCGCCGAGATCGCCCTGCCCGAAGACGCCCGCGCGGAAGCCGGCCGGTTCGGC
ATCCACCCCGCGCTGCTGGACGCGGCCCTGCACTCGACGATGGTCAGCGCCGCGGCGGAC
ACCGAGTCCTACGGCGACGAAGTGCGGCTGCCGTTCGCGTGGAACGGGCTGCGGCTGCAC
GCGGCCGGCGCCTCGGTGCTGCGGGTGCGCGTCGCCAAGCCCGAGCGGGACAGTCTGTCG
CTGGAGGCCGTCGACGAGTCCGGCGGCCTGGTCGTGACGCTGGATTCCCTGGTCGGGCGC
CCGGTGTCGAACGACCAGCTGACGACGGCGGCGGGGCCGGCGGGCGCCGGCTCGCTGTAC
CGCGTGGACTGGACGCCATTGTCCTCAGTGGACACTTCGGGACGGGTGCCGTCCTGGCTT
CCGGTCGCCACCGCGGAAGAGGTGGCGACGCTGGCCGACGACGTCCTGACCGGCGCGACC
GAGGCGCCGGCGGTGGCCGTCATGGAGGCCGTCGCCGACGAGGGTTCCGTGCTGGCGCTC
ACCGTCCGGGTGCTGGACGTGGTCCAGTGCTGGCTGGCCGGCGGCGGGCTGGAGGGGACG
AAGCTCGCGATCGTGACCCGCGGCGCGGTGCCCGCCGGCGACGGCGTGGTGCACGACCCG
GCCGCGGCCGCGGTGTGGGGGCTGGTCCGGGCCGCGCAGGCGGAGAACCCGGACCGGATC
GTCCTCCTCGACGTCGAGCCGGAAGCCGACGTACCGCCGCTGCTGGGTTCGGTGCTCGCC
GACGGCGAGCCGCAGGTCGCGGTGCGCGGAACCACGCTGTCCATCCCCCGCCTCGCCCGC
GCCGCCCGGCCCGACCCGGCCGCCGGGTTCAAGACCCGGGGACCGGTGCTGGTCACCGGC
GGGACCGGGTCGCTCGGCGGCCTGGTCGCCCGGCACCTGGTCGAGCGGCACGGCGTCCGG
CAGCTGGTGCTGGCGAGTCGCCGGGGCCTGGACGCCGAAGGCGCGAAGGACCTGGTCACC
GACCTCACCGCACTGGGGGCCGACGTCGCGGTCGCCGCTTGCGACGTCGCCGACCGGGAC
CAGGTGGCGGCCCTGCTGACCGAGCACCGGCCGTCCGCCGTGGTGCACACGGCCGGCGTC
CCGGACGCCGGGGTGATCGGGACGGTGACCCCGGACCGGCTGGCCGAGGTGTTCGCGCCC
AAGGTCACCGCGGCCCGGCACCTCGACGAGCTGACCCGCGACCTGGACCTCGACAGTTTC
GTCGTCTACTCCTCGGTTTCCGCGGTGTTCATGGGCGCCGGCAGCGGCAGCTACGCCGCG
GCGAACGCGTACCTGGACGGGCTGATGGCCCACCGGCGCGCGGCCGGCCTGCCGGGCCAG
TCGCTGGCGTGGGGGCTGTGGGACCAGACCACCGGCGGCATGGCGGCCGGGACCGACGAG
GCCGGCCGGGCCCGGATGACCCGGCGCGGCGGCCTGGTCGCGATGAAACCCGCCGCCGGA
CTGGACCTCTTCGACGCTGCCATCGGGTCCGGCGAGCCGCTGCTGGTGCCCGCCCAGCTC
GACCTGCGGGGCCTGCGCGCCGAAGCGGCGGGCGGCACCGAAGTGCCGCACCTGCTGCGC
GGCCTGGTCCGCGCCGGACGCCAGCAGGCCCGTGCGGCGTCCACTGTGGAGGAGAACTGG
GCCGGCCGGCTGGCCGGGCTCGAGCCGGCCGAGCGGGGCCAGGTCCTCCTGGAACTGGTG
CGCGCCCAGGTGGCAGGGGTCCTGGGCTACCGCGCCGCCCACCAGGTCGACCCGGACCAG
GGCCTGTTCGAGATCGGGTTCGACTCGCTCACCGCGATCGAACTCCGCAACCGGCTGCGC
GCCAGGACCGAACGGAAGATCTCGCCCGGTGTCGTCTTCGACCATCCCACGCCGGCCCTG
CTCGCCGCGCACTTGAACGAGCTGCTCCGAAAGAAGGTGTGA
[9] KS31..402
[9] AT554..872
[9] malonyl-CoA748..752
[9] DH918..1081
[9] KR1338..1513
[9] ACP1610..1680
[10] KS1702..2076
[10] AT2228..2541
[10] methylmalonyl-CoA2414..2418
[10] DH2585..2748
[10] KR3054..3230
[10] ACP3336..3406
[9] KS91..1206
[9] AT1660..2616
[9] malonyl-CoA2242..2256
[9] DH2752..3243
[9] KR4012..4539
[9] ACP4828..5040
[10] KS5104..6228
[10] AT6682..7623
[10] methylmalonyl-CoA7240..7254
[10] DH7753..8244
[10] KR9160..9690
[10] ACP10006..10218

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [748-861]  5.3e-76 G3DSA:3.40.366.10 [2413-2529]  2.4e-71 G3DSA:3.40.366.10
G3DSA:3.40.366.10   no description
IPR006162 Phosphopantetheine attachment site (PTM)
 [1638-1653]  PS00012 [3364-3379]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1603-1718]  3.8e-29 SSF47336 [3329-3409]  5.1e-21 SSF47336
SSF47336   ACP-like
 [1610-1685]  6.7e-21 G3DSA:1.10.1200.10 [3336-3410]  1.3e-18 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   no description
 [1613-1679]  5e-12 PF00550 [3339-3405]  6.6e-14 PF00550
PF00550   PP-binding
 [1610-1680]  20.937 PS50075 [3336-3406]  18.998 PS50075
PS50075   ACP_DOMAIN
IPR013968 Polyketide synthase, KR (Domain)
 [1338-1512]  2.3e-55 PF08659 [3054-3229]  9.8e-54 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [31-278]  2e-90 PF00109 [1702-1949]  8.1e-91 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [287-402]  2.3e-48 PF02801 [1958-2076]  9.5e-49 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [554-872]  2.5e-67 PF00698 [2228-2541]  7.3e-102 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [1-24]  3.2e-10 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [552-858]  4e-71 SSF52151 [2226-2524]  4.1e-68 SSF52151
SSF52151   FabD/lysophospholipase-like
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [685-747]  5.3e-17 SSF55048 [2351-2413]  7.5e-17 SSF55048
SSF55048   Probable ACP-binding domain of malonyl-CoA ACP transacylase
IPR016038 Thiolase-like, subgroup (Domain)
 [34-291]  1e-86 G3DSA:3.40.47.10 [292-455]  1.8e-65 G3DSA:3.40.47.10 [1704-1962]  3.5e-85 G3DSA:3.40.47.10 [1963-2130]  3.8e-65 G3DSA:3.40.47.10
G3DSA:3.40.47.10   no description
IPR016039 Thiolase-like (Domain)
 [23-401]  6.1e-102 SSF53901 [1694-2074]  1.5e-101 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1335-1520]  1.2e-29 G3DSA:3.40.50.720 [3056-3261]  2.8e-28 G3DSA:3.40.50.720
G3DSA:3.40.50.720   no description
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [192-208]  PS00606 [1863-1879]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [556-852]  8.5e-117 SM00827 [2230-2521]  3e-116 SM00827
SM00827   Acyl transferase domain in polyketide syntha
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1611-1683]  4.3e-32 SM00823 [3337-3409]  1.5e-29 SM00823
SM00823   Phosphopantetheine attachment site
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [918-1081]  6.5e-84 SM00826 [2585-2748]  2.7e-80 SM00826
SM00826   no description
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [33-455]  1.5e-213 SM00825 [1704-2128]  1.3e-212 SM00825
SM00825   Beta-ketoacyl synthase
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1338-1513]  1.8e-52 SM00822 [3054-3230]  3e-48 SM00822
SM00822   no description
SignalP
 [1-29]  0.197 Signal
Bacteria, Gram-negative   
TMHMM No significant hit