close all open/close all

CDS information : Rifam_00260


close this sectionLocation

Organism
StrainS699
Entry nameRifamycin
Contig
Start / Stop / Direction68,016 / 68,798 / + [in whole cluster]
68,016 / 68,798 / + [in contig]
Location68016..68798 [in whole cluster]
68016..68798 [in contig]
TypeCDS
Length783 bp (260 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productamide synthase
Product (GenBank)RifF
Gene
Gene (GenBank)rifF
EC number
Keyword
Note
Note (GenBank)
  • amide synthase
Reference
ACC
PmId
[9512878] Biosynthesis of the ansamycin antibiotic rifamycin: deductions from the molecular analysis of the rif biosynthetic gene cluster of Amycolatopsis mediterranei S699. (Chem Biol. , 1998)
[10430893] Direct evidence that the rifamycin polyketide synthase assembles polyketide chains processively. (Proc Natl Acad Sci U S A. , 1999)
[11812235] Expression and purification of the rifamycin amide synthase, RifF, an enzyme homologous to the prokaryotic arylamine N-acetyltransferases. (Protein Expr Purif. , 2002)

close this sectionSequence

selected fasta
>amide synthase [RifF]
MNVFDVETYLQRIGCGGETGVDLETLAKLQKSHLMAIPYSSLAYELRDAVNVVDLDEDDV
FVTSIAEGQGGACYHLNRLFHRLLTELGYDVTPLAGSTAEGRETFGTDVEHMFNLVTLDG
ADWLVDVGYPGPTYVEPLAVSPAVQTQYGSQFRLVEQETGYALQRRGAVTRWSVVYTFTT
QPRQWSDWKELEDNFRALVGDTTRTDTQETLCGRAFANGQVFLRQRRYLTVENGREQVRT
ITDDDEFRALVSRVLSGDHG
selected fasta
>amide synthase [RifF]
GTGAACGTGTTCGACGTGGAGACCTACCTCCAGCGGATCGGCTGCGGCGGGGAAACCGGC
GTGGACCTCGAAACGCTGGCGAAGCTGCAGAAGAGCCACCTGATGGCGATCCCGTACAGC
AGCCTCGCCTACGAACTCCGGGACGCGGTGAACGTCGTCGACCTCGACGAGGACGACGTC
TTCGTCACCAGCATCGCCGAAGGGCAGGGCGGCGCCTGCTACCACCTGAACCGGCTGTTC
CACCGGCTCCTGACCGAACTCGGCTACGACGTCACGCCGCTGGCCGGCAGCACCGCCGAA
GGCCGGGAGACCTTCGGCACCGACGTCGAGCACATGTTCAACCTGGTCACCCTGGACGGC
GCCGACTGGCTCGTGGACGTCGGCTACCCCGGCCCCACCTACGTCGAGCCACTGGCGGTC
TCGCCCGCGGTGCAGACCCAGTACGGGAGCCAGTTCCGGTTGGTGGAACAGGAAACCGGT
TATGCGCTGCAACGCCGGGGTGCGGTCACCCGCTGGAGCGTCGTCTACACGTTCACGACG
CAACCGCGTCAGTGGAGTGACTGGAAGGAACTGGAGGACAACTTCCGGGCCCTCGTGGGG
GACACCACCCGCACCGACACGCAGGAAACCCTGTGCGGCCGCGCGTTCGCGAACGGCCAG
GTCTTCCTGCGGCAGCGCCGCTACCTGACGGTCGAGAACGGCCGCGAGCAGGTGCGCACG
ATCACCGACGACGACGAGTTCCGGGCGCTGGTGTCCCGCGTGCTGTCCGGCGACCACGGC
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001447 Arylamine N-acetyltransferase (Family)
 [22-45]  5.4e-06 PR01543 [105-130]  5.4e-06 PR01543
PR01543   ANATRNSFRASE
 [22-252]  6.5e-65 PF00797
PF00797   Acetyltransf_2
SignalP No significant hit
TMHMM No significant hit