close all open/close all

CDS information : Rifam_00280


close this sectionLocation

Organism
StrainS699
Entry nameRifamycin
Contig
Start / Stop / Direction69,003 / 70,058 / + [in whole cluster]
69,003 / 70,058 / + [in contig]
Location69003..70058 [in whole cluster]
69003..70058 [in contig]
TypeCDS
Length1,056 bp (351 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productputative aminodehydroquinate synthase
Product (GenBank)RifG
Gene
Gene (GenBank)rifG
EC number4.2.3.-
Keyword
  • AHBA
Note
Note (GenBank)
  • aminodehydroquinate synthase
Reference
ACC
PmId
[9512878] Biosynthesis of the ansamycin antibiotic rifamycin: deductions from the molecular analysis of the rif biosynthetic gene cluster of Amycolatopsis mediterranei S699. (Chem Biol. , 1998)
[11278540] Mutational analysis and reconstituted expression of the biosynthetic genes involved in the formation of 3-amino-5-hydroxybenzoic acid, the starter unit of rifamycin biosynthesis in amycolatopsis Mediterranei S699. (J Biol Chem. , 2001)
Related Reference
ACC
P0A4Z4
PmId
[17586643] Functional characterization by genetic complementation of aroB-encoded dehydroquinate synthase from Mycobacterium tuberculosis H37Rv and its heterologous expression and purification. (J Bacteriol. , 2007)
[1910148] The Mycobacterium tuberculosis shikimate pathway genes: evolutionary relationship between biosynthetic and catabolic 3-dehydroquinases. (Mol Gen Genet. , 1991)

close this sectionSequence

selected fasta
>putative aminodehydroquinate synthase [RifG]
MRTTIPVRLAERSYDVLVGPGVRAALPEVVRRLGARRAVVVSARPADWVPGTGVETLLLQ
ARDGEPTKRLSTVEELCGEFARFGLTRSDVVVSCGGGTTTDVVGLAAALYHRGVAVVHLP
TSLLAQVDASVGGKTAVNLPAGENLVGAYWQPSAVLCDTDYLTTLPRREVLNGLGEIARC
HFIGAPDLRGRSRPEQIAASVTLKAGIVAQDERDTGPRHLLNYGHTLGHALEIATGFALR
HGEAVAIGTVFAGRLAGALGRLDQSGVDEHLAVVRHYGLPAALPADVDPAVLVRQMYRDK
KAITGLAFVLAGPRGAELVSDVPAPVVTDVLDRMPRDSLENLVGTTEAAAP
selected fasta
>putative aminodehydroquinate synthase [RifG]
GTGAGGACGACGATCCCGGTCCGCCTGGCGGAACGGTCCTACGACGTGCTCGTCGGCCCC
GGGGTGCGGGCGGCGCTGCCCGAGGTCGTCCGGCGGCTCGGCGCGAGACGGGCCGTGGTC
GTGTCGGCCCGGCCGGCGGACTGGGTGCCCGGCACCGGCGTCGAGACCCTGCTGCTCCAG
GCGCGCGACGGCGAGCCGACCAAGCGGCTGTCCACAGTGGAGGAACTGTGCGGTGAGTTC
GCGCGGTTCGGGCTCACCCGGTCCGACGTCGTGGTCTCCTGCGGCGGCGGCACGACCACG
GACGTCGTCGGGCTCGCGGCCGCGCTGTACCACCGGGGGGTCGCCGTGGTCCACCTGCCC
ACGTCCCTGCTCGCCCAGGTCGACGCCAGCGTCGGCGGGAAGACCGCGGTGAACCTGCCG
GCGGGCGAGAACCTCGTCGGGGCGTACTGGCAGCCCAGCGCGGTGCTGTGCGACACGGAC
TACCTGACGACGCTGCCGCGGCGGGAGGTGCTGAACGGCCTCGGCGAGATCGCCCGCTGC
CACTTCATCGGCGCGCCGGACCTGCGGGGGCGCTCGCGCCCGGAGCAGATCGCCGCCAGC
GTCACCCTCAAGGCGGGCATCGTCGCGCAGGACGAGCGGGACACCGGCCCGCGGCACCTG
CTCAACTACGGCCACACGCTGGGGCACGCGCTGGAGATCGCGACCGGCTTCGCCCTGCGC
CACGGCGAGGCGGTGGCGATCGGCACGGTCTTCGCGGGCCGGCTGGCCGGCGCGCTCGGC
CGCCTCGACCAGTCCGGTGTGGACGAACACCTCGCCGTCGTCCGCCACTACGGCCTGCCC
GCCGCGCTGCCCGCGGACGTCGACCCGGCGGTGCTCGTCCGGCAGATGTACCGGGACAAG
AAGGCGATCACCGGGCTCGCCTTCGTCCTGGCCGGGCCGCGGGGCGCGGAGCTGGTGAGC
GACGTGCCGGCGCCGGTCGTCACCGACGTCCTGGACCGGATGCCCCGCGACAGCCTGGAA
AACCTGGTGGGGACGACGGAAGCGGCGGCGCCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR016037 3-dehydroquinate synthase AroB (Family)
 [3-339]  1.3000049540733e-79 PIRSF001455
PIRSF001455   DHQ_synth
SignalP
 [1-43]  0.228 Signal
Bacteria, Gram-positive   
TMHMM No significant hit