close all open/close all

CDS information : Rifam_00290


close this sectionLocation

Organism
StrainS699
Entry nameRifamycin
Contig
Start / Stop / Direction70,055 / 71,380 / + [in whole cluster]
70,055 / 71,380 / + [in contig]
Location70055..71380 [in whole cluster]
70055..71380 [in contig]
TypeCDS
Length1,326 bp (441 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Product3,4-dideoxy-4-amino-D-arabino-heptulosonate 7-phosphate synthase
aminoDAHP synthase
Product (GenBank)RifH
Gene
Gene (GenBank)rifH
EC number
Keyword
  • AHBA
Note
Note (GenBank)
  • aminoDAHP synthase
Reference
ACC
PmId
[9512878] Biosynthesis of the ansamycin antibiotic rifamycin: deductions from the molecular analysis of the rif biosynthetic gene cluster of Amycolatopsis mediterranei S699. (Chem Biol. , 1998)
[11278540] Mutational analysis and reconstituted expression of the biosynthetic genes involved in the formation of 3-amino-5-hydroxybenzoic acid, the starter unit of rifamycin biosynthesis in amycolatopsis Mediterranei S699. (J Biol Chem. , 2001)
[11804477] Biosynthesis of 1-deoxy-1-imino-D-erythrose 4-phosphate: a defining metabolite in the aminoshikimate pathway. (J Am Chem Soc. , 2002)

close this sectionSequence

selected fasta
>3,4-dideoxy-4-amino-D-arabino-heptulosonate 7-phosphate synthase [RifH]
MKRQPDFAAHGRAVDRVLAGRLSAALARPAAQQPGWPDAERAAEVIELLHDAEPIVAPEE
TARLRARLASVARGEAFLLQGGDCAETFAGNTEPHLRANLGVLARMGEVLAEAAGLPVVK
IARMAGQFAKPRSRTVDALGLPVYRGDIVNSPECTVAARTPDPHRMLLAYAHAAGAMDLV
RKLCAEGLEEPLAAQVVLAGARRASSPGGRPFPDFGRPPRPAEIYVSHEMLLLDYERAVL
RTDSSGPEPRLSSGLAHFLWIGERPASSTAPTSTFAELLSNPIGLKLGPSCTPEEVVEYV
RRLDPHRTPGRLTLVSRMGHAQVRELLPPIVEKVAASGHEVIWQCDPMHGNTRTSGNGYK
TRHFGHVVAELAGFFAVHRQLGTHPGGIHVEVTGDDVTECLGGAAGIAEADLPDRYLTAC
DPRLNADQSVELAFAIAKMLR
selected fasta
>3,4-dideoxy-4-amino-D-arabino-heptulosonate 7-phosphate synthase [RifH]
GTGAAGCGGCAGCCGGACTTCGCGGCCCACGGCCGGGCGGTCGACCGGGTGCTGGCCGGC
CGGCTGAGCGCGGCGCTGGCCCGGCCGGCCGCGCAGCAGCCGGGCTGGCCGGACGCCGAG
CGGGCGGCCGAGGTGATCGAGCTGCTGCACGACGCCGAGCCGATCGTGGCGCCGGAGGAG
ACCGCACGGTTGCGCGCCCGGCTCGCGTCGGTCGCCCGCGGCGAGGCGTTCCTGCTGCAG
GGCGGGGACTGCGCGGAGACGTTCGCCGGCAACACCGAGCCGCACCTGCGGGCCAACCTC
GGGGTGCTGGCGCGGATGGGCGAAGTGCTGGCCGAGGCGGCCGGCCTGCCGGTGGTCAAG
ATCGCCCGGATGGCCGGGCAGTTCGCCAAGCCGCGGTCCCGGACCGTCGACGCGCTGGGC
CTGCCGGTGTACCGGGGCGACATCGTGAACTCCCCGGAGTGCACGGTCGCCGCCCGGACC
CCCGACCCGCACCGGATGCTGCTGGCATACGCCCACGCCGCCGGCGCGATGGACCTCGTC
CGCAAGCTCTGCGCCGAGGGCCTCGAAGAACCCCTGGCGGCGCAGGTGGTGCTCGCGGGC
GCCCGCCGCGCGTCGTCGCCCGGCGGGCGGCCGTTCCCGGACTTCGGCCGGCCACCGCGC
CCGGCCGAGATCTACGTCAGCCACGAAATGCTCCTGCTCGACTACGAGCGGGCCGTCCTG
CGGACGGATTCCAGCGGGCCGGAACCGCGGCTGTCCAGCGGGCTGGCGCACTTCCTGTGG
ATCGGCGAGCGCCCCGCCAGCTCGACGGCGCCCACATCGACGTTCGCGGAGCTGCTGTCC
AACCCGATCGGGCTGAAGCTGGGGCCGAGCTGCACCCCGGAGGAGGTCGTCGAGTACGTG
CGGCGGCTCGACCCGCACCGCACGCCGGGCCGGCTGACGCTGGTCAGCCGGATGGGGCAC
GCCCAGGTCCGGGAGCTCCTCCCGCCGATCGTGGAGAAGGTCGCCGCCTCCGGGCACGAG
GTGATCTGGCAGTGCGACCCGATGCACGGCAACACCCGGACCTCGGGCAACGGCTACAAG
ACCCGGCACTTCGGCCACGTCGTCGCCGAGCTGGCCGGCTTCTTCGCCGTGCACCGGCAG
CTCGGCACCCATCCCGGCGGCATCCACGTCGAGGTGACCGGCGACGACGTGACGGAATGC
CTCGGCGGGGCCGCGGGCATCGCGGAGGCCGACCTGCCCGACCGCTACCTGACCGCCTGC
GATCCGCGGCTCAACGCCGACCAGTCGGTCGAACTCGCGTTCGCGATCGCGAAGATGCTG
CGCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002480 DAHP synthetase, class II (Family)
 [24-190]  1.40000000000001e-57 PF01474 [222-437]  8.29999999999993e-92 PF01474
PF01474   DAHP_synth_2
SignalP
 [1-27]  0.122 Signal
Eukaryota   
TMHMM No significant hit