close all open/close all

CDS information : Rifam_00300


close this sectionLocation

Organism
StrainS699
Entry nameRifamycin
Contig
Start / Stop / Direction71,400 / 72,191 / + [in whole cluster]
71,400 / 72,191 / + [in contig]
Location71400..72191 [in whole cluster]
71400..72191 [in contig]
TypeCDS
Length792 bp (263 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productaminoshikimate dehydrogenase
Product (GenBank)RifI
Gene
Gene (GenBank)rifI
EC number
Keyword
  • (AHBA)
Note
Note (GenBank)
  • aminoquinate dehydrogenase
Reference
ACC
PmId
[9512878] Biosynthesis of the ansamycin antibiotic rifamycin: deductions from the molecular analysis of the rif biosynthetic gene cluster of Amycolatopsis mediterranei S699. (Chem Biol. , 1998)
[11278540] Mutational analysis and reconstituted expression of the biosynthetic genes involved in the formation of 3-amino-5-hydroxybenzoic acid, the starter unit of rifamycin biosynthesis in amycolatopsis Mediterranei S699. (J Biol Chem. , 2001)
Related Reference
PmId
[15128242] Synthesis of aminoshikimic acid. (Org Lett. , 2004)

close this sectionSequence

selected fasta
>aminoshikimate dehydrogenase [RifI]
MPISGTTRLYVVLGDPVAQVRSPGLLNPLFADLDVDAVLVPVHAPPPHLERIVAGLQAVA
NLDGIFVTVPHKVAVAGLADRRSPMVEITGSANALRREADGRWYAENFDGTGFVAGLVEA
GHDPKARRVSLVGAGGAGSAIAAAVLAAGADRLALCDPDTAKLAALKGRLDVHWPGRTSV
SAEPDTAGADLVVNATPLGLRPGDPLPFRPDRLAPGRVVADIIMKPRETRLLREAAALGH
DVHYGSHMLAGQLDSYRDFFGLG
selected fasta
>aminoshikimate dehydrogenase [RifI]
ATGCCGATCAGCGGCACCACCCGCCTGTACGTCGTGCTGGGCGACCCGGTCGCCCAGGTC
CGGTCGCCCGGGCTGCTGAACCCGCTCTTCGCGGACCTGGACGTCGACGCGGTGCTCGTC
CCGGTGCACGCGCCGCCGCCGCACCTCGAGCGGATCGTCGCCGGGCTGCAGGCCGTCGCC
AACCTCGACGGCATCTTCGTCACCGTGCCGCACAAGGTGGCCGTGGCCGGGCTCGCCGAC
CGGCGCAGCCCGATGGTGGAGATCACCGGCAGCGCCAACGCCTTGCGGCGCGAAGCCGAC
GGCCGGTGGTACGCCGAGAACTTCGACGGCACCGGCTTCGTCGCCGGGCTGGTCGAGGCC
GGGCACGACCCGAAGGCCCGGCGGGTGTCCCTCGTCGGCGCCGGTGGGGCGGGCAGCGCC
ATCGCGGCCGCCGTGCTGGCGGCCGGCGCCGACCGGCTGGCGCTGTGCGACCCGGACACC
GCGAAGCTGGCCGCCCTCAAGGGCCGCCTGGACGTGCACTGGCCGGGCCGGACGTCGGTG
TCGGCCGAGCCGGACACCGCGGGCGCCGACCTCGTCGTGAACGCGACCCCGCTCGGGCTG
CGGCCCGGCGACCCGCTGCCGTTCCGGCCGGACCGGCTGGCGCCGGGCCGCGTGGTCGCC
GACATCATCATGAAACCCCGCGAAACCCGCCTTCTCCGCGAAGCGGCGGCCCTCGGCCAC
GACGTCCATTACGGCAGCCACATGCTCGCCGGGCAATTGGACTCCTATCGCGATTTCTTC
GGCCTGGGTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000594 UBA/THIF-type NAD/FAD binding fold (Domain)
 [127-163]  6.8e-05 PF00899
PF00899   ThiF
IPR013708 Shikimate dehydrogenase substrate binding, N-terminal (Domain)
 [12-94]  7.7e-14 PF08501
PF08501   Shikimate_dh_N
IPR016040 NAD(P)-binding domain (Domain)
 [115-245]  2.9e-31 G3DSA:3.40.50.720
G3DSA:3.40.50.720   no description
SignalP No significant hit
TMHMM No significant hit