close all open/close all

CDS information : Rifam_00310


close this sectionLocation

Organism
StrainS699
Entry nameRifamycin
Contig
Start / Stop / Direction72,331 / 73,497 / + [in whole cluster]
72,331 / 73,497 / + [in contig]
Location72331..73497 [in whole cluster]
72331..73497 [in contig]
TypeCDS
Length1,167 bp (388 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Product3-amino-5-hydroxybenzoic acid synthase/UDP-3-keto-D-glucose aminotransferase
AHBA synthase/UDP-3-keto-D-glucose aminotransferase
Product (GenBank)RifK
Gene
Gene (GenBank)rifK
EC number4.2.1.144
2.6.1.-
Keyword
  • AHBA
Note
  • bifunctional protein
Note (GenBank)
  • AHBA synthase
Reference
ACC
PmId
[9497318] 3-Amino-5-hydroxybenzoic acid synthase, the terminal enzyme in the formation of the precursor of mC7N units in rifamycin and related antibiotics. (J Biol Chem. , 1998)
[9512878] Biosynthesis of the ansamycin antibiotic rifamycin: deductions from the molecular analysis of the rif biosynthetic gene cluster of Amycolatopsis mediterranei S699. (Chem Biol. , 1998)
[10433690] Crystal structure of 3-amino-5-hydroxybenzoic acid (AHBA) synthase. (Biochemistry. , 1999)
[11278540] Mutational analysis and reconstituted expression of the biosynthetic genes involved in the formation of 3-amino-5-hydroxybenzoic acid, the starter unit of rifamycin biosynthesis in amycolatopsis Mediterranei S699. (J Biol Chem. , 2001)
[12207505] Characterization of the early stage aminoshikimate pathway in the formation of 3-amino-5-hydroxybenzoic acid: the RifN protein specifically converts kanosamine into kanosamine 6-phosphate. (J Am Chem Soc. , 2002)
[21081954] The biosynthesis of 3-amino-5-hydroxybenzoic acid (AHBA), the precursor of mC7N units in ansamycin and mitomycin antibiotics: a review. (J Antibiot (Tokyo). , 2011)

close this sectionSequence

selected fasta
>3-amino-5-hydroxybenzoic acid synthase/UDP-3-keto-D-glucose aminotransferase [RifK]
MNARKAPEFPAWPQYDDAERNGLVRALEQGQWWRMGGDEVNSFEREFAAHHGAAHALAVT
NGTHALELALQVMGVGPGTEVIVPAFTFISSSQAAQRLGAVTVPVDVDAATYNLDPEAVA
AAVTPRTKVIMPVHMAGLMADMDALAKISADTGVPLLQDAAHAHGARWQGKRVGELDSIA
TFSFQNGKLMTAGEGGAVVFPDGETEKYETAFLRHSCGRPRDDRRYFHKIAGSNMRLNEF
SASVLRAQLARLDEQIAVRDEPWTLLSRLLGAIDGVVPQGGDVRADRNSHYMAMFRIPGL
TEERRNALVDRLVEAGLPAFAAFRAIYRTDAFWELGAPDESVDAIARRCPNTDAISSDCV
WLHHRVLLAGEPELHATAEIIADAVGRA
selected fasta
>3-amino-5-hydroxybenzoic acid synthase/UDP-3-keto-D-glucose aminotransferase [RifK]
ATGAACGCGCGAAAGGCACCGGAATTCCCTGCGTGGCCGCAGTACGACGACGCCGAGCGG
AACGGCTTGGTCCGCGCGCTCGAACAGGGTCAGTGGTGGCGCATGGGCGGGGACGAGGTG
AACTCCTTCGAGCGCGAGTTCGCCGCCCACCACGGCGCCGCGCACGCGCTGGCGGTCACC
AACGGCACGCACGCGCTGGAACTCGCCCTGCAGGTCATGGGCGTCGGCCCGGGCACCGAG
GTCATCGTGCCGGCCTTCACCTTCATCTCCTCGTCCCAGGCGGCCCAGCGGCTCGGCGCG
GTCACCGTCCCGGTCGACGTCGACGCGGCCACCTACAACCTCGACCCGGAGGCCGTCGCG
GCCGCCGTCACCCCGCGCACCAAGGTGATCATGCCGGTGCACATGGCCGGGCTGATGGCC
GACATGGACGCGCTGGCGAAGATCTCCGCCGACACGGGCGTCCCGCTGCTGCAGGACGCC
GCGCACGCGCACGGCGCCCGCTGGCAGGGCAAGCGCGTCGGCGAGCTGGACAGCATCGCC
ACGTTCAGCTTCCAGAACGGCAAGCTGATGACGGCGGGCGAGGGCGGCGCGGTCGTCTTC
CCCGACGGCGAGACCGAAAAGTACGAGACCGCCTTCCTCCGGCACAGCTGCGGCCGTCCC
CGCGACGACCGCCGCTACTTCCACAAGATCGCCGGCTCGAACATGCGGCTCAACGAGTTC
TCCGCGTCCGTGCTGCGCGCGCAGCTGGCCCGCCTCGACGAGCAGATCGCCGTGCGCGAC
GAGCCGTGGACCCTGCTGTCCCGGCTGCTCGGCGCGATCGACGGCGTCGTGCCCCAGGGC
GGCGACGTGCGCGCCGACCGCAACTCCCACTACATGGCCATGTTCCGCATCCCCGGGCTC
ACCGAGGAACGGCGCAACGCCCTGGTCGACCGGCTCGTCGAGGCCGGCCTGCCCGCCTTC
GCCGCGTTCCGCGCGATCTACCGCACCGACGCCTTCTGGGAGCTCGGCGCCCCCGACGAG
AGCGTGGACGCGATCGCCCGGCGCTGCCCGAACACGGACGCGATCAGCAGCGACTGCGTC
TGGCTGCACCACCGGGTCCTGCTGGCCGGCGAGCCGGAGCTGCACGCGACCGCCGAAATC
ATCGCCGACGCCGTGGGCCGGGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000653 DegT/DnrJ/EryC1/StrS aminotransferase (Family)
 [1-388]  9.49996855930963e-110 PIRSF000390
PIRSF000390   PLP_StrS
 [15-372]  1.9e-117 PF01041
PF01041   DegT_DnrJ_EryC1
IPR015421 Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (Domain)
 [11-250]  4.09999999999995e-73 G3DSA:3.40.640.10
G3DSA:3.40.640.10   PyrdxlP-dep_Trfase_major_sub1
IPR015422 Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (Domain)
 [251-386]  1e-60 G3DSA:3.90.1150.10
G3DSA:3.90.1150.10   PyrdxlP-dep_Trfase_major_sub2
IPR015424 Pyridoxal phosphate-dependent transferase, major domain (Domain)
 [5-388]  7.60000011115808e-101 SSF53383
SSF53383   PyrdxlP-dep_Trfase_major
SignalP No significant hit
TMHMM No significant hit