close all open/close all

CDS information : Rifam_00320


close this sectionLocation

Organism
StrainS699
Entry nameRifamycin
Contig
Start / Stop / Direction73,571 / 74,647 / + [in whole cluster]
73,571 / 74,647 / + [in contig]
Location73571..74647 [in whole cluster]
73571..74647 [in contig]
TypeCDS
Length1,077 bp (358 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
ProductUDP-glucose C-3 dehydrogenase
Product (GenBank)RifL
Gene
Gene (GenBank)rifL
EC number
Keyword
  • AHBA
Note
Note (GenBank)
  • putative oxidoreductase
Reference
ACC
PmId
[9512878] Biosynthesis of the ansamycin antibiotic rifamycin: deductions from the molecular analysis of the rif biosynthetic gene cluster of Amycolatopsis mediterranei S699. (Chem Biol. , 1998)
[11278540] Mutational analysis and reconstituted expression of the biosynthetic genes involved in the formation of 3-amino-5-hydroxybenzoic acid, the starter unit of rifamycin biosynthesis in amycolatopsis Mediterranei S699. (J Biol Chem. , 2001)
[12207504] Kanosamine biosynthesis: a likely source of the aminoshikimate pathway's nitrogen atom. (J Am Chem Soc. , 2002)
[12207505] Characterization of the early stage aminoshikimate pathway in the formation of 3-amino-5-hydroxybenzoic acid: the RifN protein specifically converts kanosamine into kanosamine 6-phosphate. (J Am Chem Soc. , 2002)
[21081954] The biosynthesis of 3-amino-5-hydroxybenzoic acid (AHBA), the precursor of mC7N units in ansamycin and mitomycin antibiotics: a review. (J Antibiot (Tokyo). , 2011)

close this sectionSequence

selected fasta
>UDP-glucose C-3 dehydrogenase [RifL]
MSVRAAVVGLGWAGRELWLPLLREHADFEVVAAVDADPASRQAFTKATGIPTHAAVSALT
AREVDLAVVAVPNYLHTEVAGALLATGISVFLEKPVCLNSAEIDVLAAAERSGGMLLAGS
AARYRGDVGALRRLLPELGEIRHVALGWIRARGVPRAGGWFTQREKAGGGALYDLGWHLL
DTLAFLLGPAAFTQVIGVTSDDFVNAGAWRAAWRQDQLGADAADVEDTARGFLVRDDGVS
VSLRASWASHQARDVSVIHVEGSAGTADLRCTFGFSPNREPEPVLSVTREGTTTRLPVPL
ERIGVEYTRQVSDLAAMLADPGHRGRAVAEARPIVSMIENFYASAGSARGRGAVPAYQ
selected fasta
>UDP-glucose C-3 dehydrogenase [RifL]
ATGAGCGTCCGGGCCGCGGTGGTCGGGCTCGGCTGGGCCGGCCGGGAACTGTGGCTGCCC
CTGCTGCGCGAGCACGCTGACTTCGAGGTGGTCGCCGCGGTGGACGCCGATCCGGCGTCG
CGGCAGGCGTTCACGAAGGCGACCGGCATCCCCACGCACGCCGCGGTGTCCGCGCTGACC
GCGCGCGAGGTCGACCTCGCCGTCGTCGCGGTGCCCAACTACCTGCATACCGAGGTGGCG
GGCGCGCTGCTCGCCACCGGGATCTCCGTCTTCCTCGAGAAGCCGGTGTGCCTGAACTCC
GCCGAGATCGACGTCCTCGCGGCGGCCGAACGCAGCGGCGGGATGCTGCTGGCCGGCAGT
GCCGCCCGCTACCGCGGTGACGTCGGTGCGCTGCGGCGGCTCCTGCCGGAGCTGGGCGAG
ATCCGGCACGTCGCCTTGGGCTGGATCCGGGCGCGGGGTGTCCCGCGCGCGGGCGGCTGG
TTCACCCAGCGCGAGAAGGCCGGCGGGGGAGCGCTGTACGACCTCGGCTGGCACTTGCTC
GACACGCTCGCGTTCCTGCTCGGCCCGGCCGCCTTCACCCAGGTCATCGGCGTGACGTCG
GACGACTTCGTCAACGCCGGCGCCTGGCGTGCGGCGTGGCGGCAGGACCAGCTCGGCGCG
GACGCCGCCGACGTCGAGGACACCGCGCGCGGCTTCCTGGTCCGCGACGACGGCGTCTCG
GTCTCCCTGCGGGCGAGCTGGGCCTCGCACCAGGCGCGGGACGTCTCGGTGATCCACGTC
GAGGGCAGCGCCGGCACCGCGGACCTGCGGTGCACCTTCGGCTTCAGCCCCAACCGCGAG
CCCGAGCCCGTGCTGTCGGTGACCCGCGAGGGCACCACCACCCGGCTGCCCGTGCCGCTC
GAGCGCATCGGCGTCGAATACACGCGCCAGGTGAGCGACCTCGCCGCGATGCTGGCCGAT
CCCGGCCACCGCGGCCGGGCCGTCGCCGAAGCGCGGCCGATCGTCTCGATGATCGAGAAC
TTCTACGCCTCCGCGGGCTCGGCGCGCGGCCGGGGTGCGGTTCCGGCGTACCAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000683 Oxidoreductase, N-terminal (Domain)
 [3-114]  2e-22 PF01408
PF01408   GFO_IDH_MocA
IPR004104 Oxidoreductase, C-terminal (Domain)
 [137-190]  6.1e-08 PF02894
PF02894   GFO_IDH_MocA_C
IPR016040 NAD(P)-binding domain (Domain)
 [3-140]  2.6e-29 G3DSA:3.40.50.720
G3DSA:3.40.50.720   no description
SignalP
 [1-33]  0.333 Signal
Eukaryota   
TMHMM No significant hit