close all open/close all

CDS information : Rifam_00330


close this sectionLocation

Organism
StrainS699
Entry nameRifamycin
Contig
Start / Stop / Direction74,662 / 75,360 / + [in whole cluster]
74,662 / 75,360 / + [in contig]
Location74662..75360 [in whole cluster]
74662..75360 [in contig]
TypeCDS
Length699 bp (232 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productputative hydrolase
Product (GenBank)RifM
Gene
Gene (GenBank)rifM
EC number
Keyword
  • AHBA
Note
Note (GenBank)
  • putative phosphatase
Reference
ACC
PmId
[9512878] Biosynthesis of the ansamycin antibiotic rifamycin: deductions from the molecular analysis of the rif biosynthetic gene cluster of Amycolatopsis mediterranei S699. (Chem Biol. , 1998)
[11278540] Mutational analysis and reconstituted expression of the biosynthetic genes involved in the formation of 3-amino-5-hydroxybenzoic acid, the starter unit of rifamycin biosynthesis in amycolatopsis Mediterranei S699. (J Biol Chem. , 2001)
[12207505] Characterization of the early stage aminoshikimate pathway in the formation of 3-amino-5-hydroxybenzoic acid: the RifN protein specifically converts kanosamine into kanosamine 6-phosphate. (J Am Chem Soc. , 2002)
Related Reference
ACC
Q9X0Y1
PmId
[15808744] Enzyme genomics: Application of general enzymatic screens to discover new enzymes. (FEMS Microbiol Rev. , 2005)

close this sectionSequence

selected fasta
>putative hydrolase [RifM]
MTFPIVDRPDTGADPSAPVRHAVIFDLDGVVVDSFAVMSEAFAIAYAEVVGDGPAPFEEY
RRHLGRYFPDIMRIMDLPLEMEEPFVRESYRLAGEVQVFDGVTELLLTLRTRGLRLAIAT
GKSGPRARSLLDNLGLLPFFEHVIGSDEVARPKPAPDIVRHALDLLDVPPEAAIMIGDAP
TDLASARGAGVASAAALWAPPDDIGELLAAGPDVVLRQPADLLALCPSVPGR
selected fasta
>putative hydrolase [RifM]
ATGACATTCCCGATCGTCGACCGGCCGGACACCGGGGCCGATCCCTCGGCACCGGTCCGG
CACGCGGTCATCTTCGACCTCGACGGGGTCGTCGTCGACAGCTTCGCGGTGATGAGCGAG
GCCTTCGCCATCGCCTACGCCGAGGTGGTCGGCGACGGGCCCGCGCCCTTCGAGGAGTAT
CGGCGCCACCTCGGTCGATACTTTCCGGATATCATGCGGATCATGGACCTTCCACTGGAG
ATGGAGGAACCCTTCGTCCGCGAGAGCTACCGCCTCGCCGGCGAAGTCCAGGTCTTCGAC
GGGGTCACCGAGCTGCTCCTGACGCTGCGGACGCGTGGCCTGCGGCTGGCCATCGCCACC
GGCAAGAGCGGGCCGCGGGCCCGGTCCCTGCTCGACAACCTCGGCCTGCTCCCGTTCTTC
GAGCACGTCATCGGCTCCGACGAGGTCGCCCGGCCCAAGCCGGCGCCCGACATCGTGCGC
CACGCGCTGGACCTGCTGGACGTCCCGCCGGAGGCGGCCATCATGATCGGCGACGCCCCC
ACCGACCTGGCCAGCGCCCGAGGCGCCGGCGTCGCGTCGGCCGCCGCGCTGTGGGCGCCC
CCGGACGACATCGGCGAGCTGCTCGCCGCCGGTCCCGACGTGGTGCTGCGACAGCCGGCC
GACCTGCTCGCGCTCTGTCCGTCGGTGCCCGGCCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005833 Haloacid dehalogenase/epoxide hydrolase (Family)
 [20-31]  2.8e-09 PR00413 [109-122]  2.8e-09 PR00413 [140-156]  2.8e-09 PR00413 [158-178]  2.8e-09 PR00413
PR00413   HADHALOGNASE
IPR006351 3-amino-5-hydroxybenzoic acid synthesis-related (Family)
 [23-228]  6.6e-120 TIGR01454
TIGR01454   AHBA_synth_RP: AHBA synthesis associated protein
IPR006402 HAD-superfamily hydrolase, subfamily IA, variant 3 (Family)
 [92-191]  2.1e-09 TIGR01509
TIGR01509   HAD-SF-IA-v3: HAD hydrolase, family IA, variant 3
IPR006439 HAD-superfamily hydrolase, subfamily IA, variant 1 (Family)
 [109-190]  1.4e-09 TIGR01549
TIGR01549   HAD-SF-IA-v1: HAD hydrolase, family IA, variant 1
IPR023214 HAD-like domain (Domain)
 [94-225]  2e-37 G3DSA:3.40.50.1000
G3DSA:3.40.50.1000   no description
 [22-226]  1.8e-46 SSF56784
SSF56784   HAD-like
SignalP No significant hit
TMHMM No significant hit