close all open/close all

CDS information : Rifam_00340


close this sectionLocation

Organism
StrainS699
Entry nameRifamycin
Contig
Start / Stop / Direction75,365 / 76,276 / + [in whole cluster]
75,365 / 76,276 / + [in contig]
Location75365..76276 [in whole cluster]
75365..76276 [in contig]
TypeCDS
Length912 bp (303 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productkanosamine kinase
Product (GenBank)RifN
Gene
Gene (GenBank)rifN
EC number
Keyword
  • AHBA
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
  • kanosamine kinase
Reference
ACC
PmId
[9512878] Biosynthesis of the ansamycin antibiotic rifamycin: deductions from the molecular analysis of the rif biosynthetic gene cluster of Amycolatopsis mediterranei S699. (Chem Biol. , 1998)
[11278540] Mutational analysis and reconstituted expression of the biosynthetic genes involved in the formation of 3-amino-5-hydroxybenzoic acid, the starter unit of rifamycin biosynthesis in amycolatopsis Mediterranei S699. (J Biol Chem. , 2001)
[12207505] Characterization of the early stage aminoshikimate pathway in the formation of 3-amino-5-hydroxybenzoic acid: the RifN protein specifically converts kanosamine into kanosamine 6-phosphate. (J Am Chem Soc. , 2002)

close this sectionSequence

selected fasta
>kanosamine kinase [RifN]
MGTPYHLGIDVGGTKVAFRVESGSACIEETSFSWGARHSAEDDLAQLAGHVARLRERIGT
PLEAVGVAMPGTVGADGRVATWPSRPEWTGVDLKTALHSLFPEAAVAWADDGDLGALAES
RASGCENLLYIGIGTGIGGGLVLGGVPCPGLGRGSFEIGHVIVEMGGVRCVCGRRGCLQA
LASGPATLRRASLLRGADVTYYRLQRALRNGEPWAADALEGSTRALAAAVTGVQELVHPD
RVLIGGGFAAGIPEIVPSVSGFLADLVRQGQAPLPVEPAALGGLSSLRGAVALAGLVAAG
EVP
selected fasta
>kanosamine kinase [RifN]
GTGGGCACCCCGTACCACCTCGGCATCGACGTGGGAGGCACGAAAGTCGCCTTCCGCGTC
GAGTCCGGCTCCGCCTGTATCGAGGAAACCTCGTTCAGCTGGGGAGCCCGGCACAGTGCC
GAGGACGACCTCGCCCAGCTGGCCGGCCACGTGGCCCGGCTGCGGGAGCGCATCGGCACG
CCGCTGGAGGCGGTCGGGGTCGCCATGCCCGGCACCGTCGGCGCGGACGGCCGGGTCGCG
ACCTGGCCCAGCCGCCCGGAGTGGACCGGGGTGGACCTGAAAACGGCGTTGCACTCGCTG
TTCCCCGAAGCGGCGGTCGCCTGGGCGGACGACGGCGATCTCGGCGCGCTCGCCGAGTCC
CGGGCGTCGGGCTGCGAGAACCTGCTGTACATCGGGATCGGCACCGGCATCGGCGGCGGC
CTGGTCCTGGGTGGCGTGCCGTGCCCCGGCCTCGGCCGCGGTTCGTTCGAGATCGGCCAC
GTGATCGTGGAGATGGGCGGCGTCCGCTGTGTGTGCGGCCGCCGCGGCTGCCTGCAGGCA
CTCGCCTCCGGCCCGGCGACCCTCCGCCGCGCGAGCCTGTTGCGCGGAGCGGACGTCACC
TACTACCGGCTGCAGCGGGCGCTGCGCAACGGAGAGCCGTGGGCGGCCGACGCGCTGGAA
GGAAGCACCCGGGCGCTGGCGGCCGCGGTGACCGGCGTCCAGGAGCTGGTCCACCCGGAC
CGCGTGCTGATCGGCGGCGGGTTCGCGGCGGGGATCCCGGAGATCGTGCCGTCGGTGTCG
GGGTTCCTGGCGGATCTGGTGCGACAGGGTCAGGCGCCGCTGCCGGTGGAACCGGCCGCG
TTGGGCGGGCTGTCGTCGTTGCGGGGAGCGGTGGCCCTCGCCGGGCTGGTGGCGGCGGGG
GAAGTGCCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000600 ROK (Family)
 [8-186]  6.7e-24 PF00480
PF00480   ROK
SignalP No significant hit
TMHMM No significant hit