close all open/close all

CDS information : Rifam_00350


close this sectionLocation

Organism
StrainS699
Entry nameRifamycin
Contig
Start / Stop / Direction76,343 / 77,110 / + [in whole cluster]
76,343 / 77,110 / + [in contig]
Location76343..77110 [in whole cluster]
76343..77110 [in contig]
TypeCDS
Length768 bp (255 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)RifO
Gene
Gene (GenBank)rifO
EC number
Keyword
Note
Note (GenBank)
  • putative regulatory protein
Reference
ACC
PmId
[9512878] Biosynthesis of the ansamycin antibiotic rifamycin: deductions from the molecular analysis of the rif biosynthetic gene cluster of Amycolatopsis mediterranei S699. (Chem Biol. , 1998)
[11278540] Mutational analysis and reconstituted expression of the biosynthetic genes involved in the formation of 3-amino-5-hydroxybenzoic acid, the starter unit of rifamycin biosynthesis in amycolatopsis Mediterranei S699. (J Biol Chem. , 2001)

close this sectionSequence

selected fasta
>hypothetical protein [RifO]
MGTLVSFHAHPNDDTTTCGGVLRKAHEDGHRVVLVLATRGELGYNPDGLLAEGETLGDRR
AVEARAAADVLGVDRLEFLGYTDSGMTAAADGAGTFQTADVEEAARKLAAILREERADVL
TVYDEKGTYGDPDHIQVHRVGTRAAELAGTAKVFQSTINREHIKANQRVLAEQAGVDLPA
GPDFGTPEAELTCRVDVSAYTEYKRKALLAHASQITPQSTLFTDLPEDTFRTMFGTEWFI
RAGQGPGITETDLMA
selected fasta
>hypothetical protein [RifO]
ATGGGCACTCTCGTTTCCTTCCACGCACACCCCAACGACGACACCACCACCTGCGGAGGC
GTCCTGCGCAAGGCCCACGAGGACGGCCACCGCGTCGTCCTCGTGCTCGCCACCCGCGGC
GAACTCGGCTACAACCCGGACGGTCTCCTCGCCGAGGGCGAGACCTTGGGCGACCGACGG
GCCGTCGAAGCCCGGGCGGCCGCCGACGTGCTCGGGGTGGACCGGCTCGAGTTCCTCGGC
TACACCGATTCCGGGATGACGGCCGCGGCCGACGGCGCCGGCACGTTCCAGACCGCCGAC
GTCGAGGAAGCGGCGCGGAAGCTCGCCGCGATCCTGCGCGAGGAGCGGGCGGACGTGCTG
ACGGTGTACGACGAGAAGGGCACCTACGGCGACCCCGACCACATCCAGGTGCACCGCGTC
GGCACGCGGGCCGCGGAACTGGCGGGCACGGCGAAGGTCTTCCAGTCCACGATCAACCGC
GAGCACATCAAGGCGAACCAGCGCGTGCTCGCCGAGCAGGCCGGCGTCGACCTGCCCGCG
GGCCCGGACTTCGGCACCCCGGAGGCCGAGCTCACCTGCCGCGTCGACGTCTCCGCGTAC
ACCGAGTACAAGCGCAAGGCGCTGCTCGCCCACGCCAGCCAGATCACCCCGCAGTCCACG
CTGTTCACGGACCTGCCGGAGGACACGTTCCGCACCATGTTCGGCACCGAGTGGTTCATC
CGCGCCGGTCAGGGGCCGGGCATCACCGAAACCGACCTGATGGCGTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003737 N-acetylglucosaminyl phosphatidylinositol deacetylase (Family)
 [7-144]  4.4e-23 PF02585
PF02585   PIG-L
IPR024078 Putative deacetylase LmbE-like domain (Domain)
 [3-233]  1.6e-45 G3DSA:3.40.50.10320
G3DSA:3.40.50.10320   no description
 [1-250]  6.4e-53 SSF102588
SSF102588   LmbE-like
SignalP No significant hit
TMHMM No significant hit