close all open/close all

CDS information : Rifam_00370


close this sectionLocation

Organism
StrainS699
Entry nameRifamycin
Contig
Start / Stop / Direction78,416 / 79,984 / + [in whole cluster]
78,416 / 79,984 / + [in contig]
Location78416..79984 [in whole cluster]
78416..79984 [in contig]
TypeCDS
Length1,569 bp (522 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productrifamycin resistance transporter
Product (GenBank)RifP
Gene
Gene (GenBank)rifP
EC number
Keyword
Note
Note (GenBank)
  • putative efflux transporter protein
Reference
ACC
PmId
[9512878] Biosynthesis of the ansamycin antibiotic rifamycin: deductions from the molecular analysis of the rif biosynthetic gene cluster of Amycolatopsis mediterranei S699. (Chem Biol. , 1998)
[17351715] RifP; a membrane protein involved in rifamycin export in Amycolatopsis mediterranei. (Biotechnol Lett. , 2007)

close this sectionSequence

selected fasta
>rifamycin resistance transporter [RifP]
MHATAAVTETRNPRRWLILAVISLAQLVVLVDNTVLNLAIPKLTEDLGATTADIQWMINA
YALVQSGLLLTAGSFSDRYGRKRSLLAGLLLFGVGSLAAAFSLSSGQLIAARAGMGIGGA
LLTTTTLAVVMQVFDEKELPKAIGLWSAVSSFGYASGPLIGGALLAHFWWGSIFLINIPV
ALLGCVAVAKLVPESKDPQGARPDLVGAALSTIGMAGIVYAIISGPEHGWASATVLVAAG
IGVAALAAFVRWELHVPHPMLDMGLFRNRRFNGAISGGLLVAFGMGGSVFLLTQQLQLVL
GYDPLEAGLRTAPLALVVVALNVAGLGAKLLEKLGIAMTIAVGMTLNAVGLAMVAVLGTP
DRGFGGMLACLLVMGGGIAPAMPAMANAIMTSIPAEKAGAGAAVQGTVNQFGSGLGVAIL
GAVLNSRFAALLPIGLGAGAAGSLHEALLQARTPALQAQVRDAFAGGVRASELIGALAVV
LGGMLAGMLLRRAARSEAHQAAWARPTIRLEAAPAPFTVDLR
selected fasta
>rifamycin resistance transporter [RifP]
ATGCACGCCACGGCGGCGGTGACCGAAACCCGGAATCCACGGCGCTGGCTGATTCTGGCC
GTCATCTCGCTGGCCCAGCTGGTCGTCCTGGTCGACAACACGGTTTTGAACCTGGCCATC
CCCAAGCTCACCGAAGATCTCGGCGCCACCACCGCCGATATCCAATGGATGATCAACGCC
TACGCCCTCGTCCAATCCGGGCTGCTTTTGACGGCCGGCAGTTTCAGTGACCGGTACGGC
CGGAAACGGTCGTTGCTCGCCGGGCTCCTGCTGTTCGGCGTGGGTTCGCTGGCCGCGGCG
TTCAGCCTGTCGTCCGGGCAGCTGATCGCCGCGCGGGCCGGGATGGGCATCGGCGGTGCG
CTGCTGACCACCACCACGCTGGCCGTCGTCATGCAGGTCTTCGACGAAAAAGAACTGCCG
AAGGCGATCGGGCTGTGGAGCGCGGTCAGCTCCTTCGGCTACGCCAGCGGCCCGCTGATC
GGCGGCGCGCTGCTCGCGCACTTCTGGTGGGGCTCGATCTTCCTCATCAACATCCCGGTG
GCGCTGCTCGGCTGCGTCGCCGTGGCGAAACTCGTGCCGGAATCCAAGGACCCGCAAGGC
GCCCGGCCCGATCTGGTCGGTGCCGCGCTCTCCACGATCGGCATGGCCGGGATCGTCTAC
GCGATCATCTCCGGCCCGGAGCACGGCTGGGCCTCGGCCACCGTCCTGGTGGCGGCCGGC
ATCGGCGTGGCCGCGCTGGCCGCGTTCGTCCGGTGGGAGCTGCACGTGCCGCACCCCATG
CTCGACATGGGTTTATTCCGCAACCGCCGGTTCAACGGCGCGATCTCCGGCGGCCTGCTG
GTCGCCTTCGGGATGGGCGGCTCGGTCTTCCTGCTGACGCAGCAACTGCAGCTCGTGCTC
GGCTACGACCCCCTGGAGGCCGGGCTCCGGACGGCTCCGCTCGCGCTGGTGGTCGTCGCG
CTGAACGTCGCCGGGCTCGGCGCGAAGCTGCTCGAGAAGCTGGGCATCGCCATGACGATC
GCCGTCGGGATGACGCTGAACGCCGTCGGGCTCGCCATGGTGGCCGTGCTGGGCACGCCC
GATCGCGGGTTCGGCGGAATGCTGGCCTGCCTGCTCGTCATGGGTGGCGGTATCGCGCCG
GCCATGCCCGCCATGGCCAACGCCATCATGACCTCGATCCCGGCCGAGAAGGCGGGGGCG
GGAGCCGCGGTGCAGGGCACCGTGAACCAGTTCGGCAGCGGGCTCGGCGTCGCCATCCTC
GGCGCCGTGCTCAACTCGCGGTTCGCCGCGCTGCTGCCGATCGGCCTCGGTGCCGGCGCC
GCCGGTTCGCTGCACGAAGCGCTGCTCCAGGCGCGGACCCCCGCACTGCAGGCGCAGGTG
CGCGACGCCTTCGCCGGCGGCGTGCGCGCCAGCGAGCTGATCGGGGCGCTGGCCGTGGTC
CTCGGCGGCATGCTCGCCGGCATGCTGCTGCGCCGGGCGGCCCGGTCGGAGGCGCACCAG
GCGGCCTGGGCCCGCCCCACGATCAGGCTGGAAGCGGCCCCTGCCCCCTTTACCGTTGAC
CTCCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001411 Tetracycline resistance protein TetB/drug resistance transporter (Family)
 [21-45]  1.9000006847787e-07 PR01036 [112-132]  1.9000006847787e-07 PR01036 [142-166]  1.9000006847787e-07 PR01036 [407-426]  1.9000006847787e-07 PR01036
PR01036   TCRTETB
IPR011701 Major facilitator superfamily (Family)
 [23-416]  1.80000000000002e-51 PF07690
PF07690   MFS_1
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [1-495]  1.3000049540733e-69 SSF103473
SSF103473   MFS_gen_substrate_transporter
IPR020846 Major facilitator superfamily domain (Domain)
 [18-494]  PS50850
PS50850   MFS
SignalP
 [1-31]  0.471 Signal
Eukaryota   
TMHMM
 [17-39]  Transmembrane (i-o) [54-76]  Transmembrane (o-i) [85-104]  Transmembrane (i-o) [108-130]  Transmembrane (o-i) [143-165]  Transmembrane (i-o) [170-192]  Transmembrane (o-i) [205-224]  Transmembrane (i-o) [228-250]  Transmembrane (o-i) [271-293]  Transmembrane (i-o) [308-327]  Transmembrane (o-i) [334-356]  Transmembrane (i-o) [371-393]  Transmembrane (o-i) [414-436]  Transmembrane (i-o) [473-490]  Transmembrane (o-i)
Transmembrane 14