close all open/close all

CDS information : Rifam_00380


close this sectionLocation

Organism
StrainS699
Entry nameRifamycin
Contig
Start / Stop / Direction80,000 / 80,728 / + [in whole cluster]
80,000 / 80,728 / + [in contig]
Location80000..80728 [in whole cluster]
80000..80728 [in contig]
TypeCDS
Length729 bp (242 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative TetR family transcriptional regulator
Product (GenBank)RifQ
Gene
Gene (GenBank)rifQ
EC number
Keyword
Note
Note (GenBank)
  • putative tetR-like transcription regulatory protein
Reference
ACC
PmId
[9512878] Biosynthesis of the ansamycin antibiotic rifamycin: deductions from the molecular analysis of the rif biosynthetic gene cluster of Amycolatopsis mediterranei S699. (Chem Biol. , 1998)
Related Reference
ACC
Q9AJL5
NITE
Virg_00370
PmId
[11222601] Identification of the varR gene as a transcriptional regulator of virginiamycin S resistance in Streptomyces virginiae. (J Bacteriol. , 2001)
ACC
Q9F0Y2
PmId
[11050092] A transcriptional regulator of a pristinamycin resistance gene in Streptomyces coelicolor. (J Biol Chem. , 2001)

close this sectionSequence

selected fasta
>putative TetR family transcriptional regulator [RifQ]
MGKRASQPRESVWLSPRPARKHRAGESELDREKIVATAVRVLDAEGDAKFSMRLLAEELN
VTPMSVYWYVANKDDLLELALDAVAGEIELPSLDDGNDWREDLRALARAWRRTMVAHPWA
IRCYGEYLNIGPSSLRFTECAQAVMACSPLPLKDRSAALNVVFQYVYGFTATESRWLEHL
AETGRTAEEFAAEVTGSMAAMSSTLEQGGLLERDGDQSMEQLRDRDFDRGLNWLFTGMVA
GG
selected fasta
>putative TetR family transcriptional regulator [RifQ]
ATGGGCAAACGGGCCTCGCAGCCCCGCGAGAGCGTGTGGCTTTCCCCGCGGCCGGCCCGC
AAGCACCGGGCCGGCGAATCCGAGCTCGACCGCGAAAAGATCGTCGCCACCGCGGTCCGC
GTCCTCGACGCCGAGGGCGACGCGAAGTTCTCGATGCGGCTGCTGGCCGAGGAACTCAAC
GTGACCCCGATGTCGGTGTACTGGTACGTCGCGAACAAGGACGACCTGCTCGAGCTGGCC
CTCGATGCGGTGGCCGGCGAGATCGAGCTCCCGTCGCTCGACGACGGCAACGACTGGCGC
GAGGACCTGCGCGCGCTCGCCCGCGCGTGGCGCCGCACGATGGTGGCCCACCCGTGGGCG
ATCCGCTGCTACGGCGAGTACCTGAACATCGGCCCGAGCAGCCTCCGCTTCACCGAGTGC
GCCCAGGCGGTGATGGCGTGCTCACCGTTGCCGCTGAAGGACCGCTCGGCGGCGCTGAAC
GTGGTCTTCCAGTACGTCTACGGCTTCACGGCGACGGAGAGCCGCTGGCTGGAGCACCTC
GCCGAAACGGGCCGCACGGCGGAGGAGTTCGCCGCCGAGGTGACGGGCAGCATGGCGGCG
ATGTCCTCGACGCTGGAGCAGGGCGGCCTGCTGGAGCGGGACGGCGACCAGTCGATGGAG
CAGCTGCGGGACCGGGACTTCGACCGCGGGCTGAACTGGCTGTTCACCGGCATGGTCGCC
GGCGGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001647 DNA-binding HTH domain, TetR-type (Domain)
 [28-88]  15.938 PS50977
PS50977   HTH_TETR_2
 [34-78]  1.4e-11 PF00440
PF00440   TetR_N
IPR004111 Tetracycline transcriptional regulator, TetR, C-terminal (Domain)
 [94-239]  6.1e-14 PF02909
PF02909   TetR_C
IPR009057 Homeodomain-like (Domain)
 [29-94]  4.7e-12 SSF46689
SSF46689   Homeodomain-like
 [19-83]  8.3e-20 G3DSA:1.10.10.60
G3DSA:1.10.10.60   no description
IPR011075 Tetracycline transcriptional regulator, TetR-related, C-terminal (Domain)
 [97-238]  7.6e-25 SSF48498
SSF48498   Tetracyclin repressor-like, C-terminal domain
IPR015893 Tetracycline transcriptional regulator, TetR-like, C-terminal (Domain)
 [84-238]  1e-21 G3DSA:1.10.357.10
G3DSA:1.10.357.10   no description
SignalP No significant hit
TMHMM No significant hit