close all open/close all

CDS information : Rifam_00390


close this sectionLocation

Organism
StrainS699
Entry nameRifamycin
Contig
Start / Stop / Direction81,235 / 80,735 / - [in whole cluster]
81,235 / 80,735 / - [in contig]
Locationcomplement(80735..81235) [in whole cluster]
complement(80735..81235) [in contig]
TypeCDS
Length501 bp (166 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.2 function unknown
Productpyridoxamine 5'-phosphate oxidase-like FMN-binding domain protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF3
Reference
ACC
PmId
[9512878] Biosynthesis of the ansamycin antibiotic rifamycin: deductions from the molecular analysis of the rif biosynthetic gene cluster of Amycolatopsis mediterranei S699. (Chem Biol. , 1998)
[16079331] Identification of tailoring genes involved in the modification of the polyketide backbone of rifamycin B by Amycolatopsis mediterranei S699. (Microbiology. , 2005)
Family/Domain
FD
IPR011576

close this sectionSequence

selected fasta
>pyridoxamine 5'-phosphate oxidase-like FMN-binding domain protein [hypothetical protein]
MDLSMTEKEEQEFLAGKHIGVLAVHRRSGPPLAVPMWYGYSPGGDVLLWTDGEDTLKGRL
IKKNGAFTLVVQNEDPPYRYVSVSGPVTAWEEATVEAAYSVASRYLPERQAREFVEAFNA
GHVIIRMTPDRWRSVDYGKTSNVLTDREGTRLREHVQTARRGRGRD
selected fasta
>pyridoxamine 5'-phosphate oxidase-like FMN-binding domain protein [hypothetical protein]
GTGGACCTGAGCATGACCGAGAAGGAAGAGCAGGAGTTCCTGGCCGGCAAGCACATCGGC
GTGCTGGCGGTGCACCGGCGAAGCGGCCCGCCGCTGGCGGTACCGATGTGGTACGGCTAC
TCCCCCGGCGGCGACGTGCTGTTGTGGACCGACGGCGAGGACACCTTGAAGGGCAGGCTG
ATCAAGAAGAACGGCGCCTTCACCTTGGTGGTCCAGAACGAGGATCCGCCCTACCGGTAC
GTTTCCGTGTCGGGTCCGGTGACGGCGTGGGAAGAAGCCACCGTCGAGGCCGCGTATTCG
GTGGCGTCGCGGTACCTGCCAGAGCGGCAGGCGCGGGAGTTCGTCGAGGCGTTCAACGCG
GGCCACGTGATCATCCGGATGACGCCGGACCGCTGGCGCAGCGTCGACTACGGCAAGACG
TCGAACGTCCTCACCGACCGCGAAGGGACCCGGCTGCGGGAACACGTGCAGACGGCCCGG
CGCGGGCGCGGGCGCGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009002 FMN-binding split barrel-related (Domain)
 [5-134]  7.7e-24 SSF50475
SSF50475   FMN-binding split barrel
IPR011576 Pyridoxamine 5'-phosphate oxidase-like, FMN-binding domain (Domain)
 [8-93]  1.4e-12 PF01243
PF01243   Pyridox_oxidase
IPR012349 FMN-binding split barrel (Domain)
 [5-140]  4.3e-18 G3DSA:2.30.110.10
G3DSA:2.30.110.10   no description
SignalP No significant hit
TMHMM No significant hit