close all open/close all

CDS information : Rifam_00400


close this sectionLocation

Organism
StrainS699
Entry nameRifamycin
Contig
Start / Stop / Direction82,531 / 81,320 / - [in whole cluster]
82,531 / 81,320 / - [in contig]
Locationcomplement(81320..82531) [in whole cluster]
complement(81320..82531) [in contig]
TypeCDS
Length1,212 bp (403 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative cytochrome P450
Product (GenBank)putative cytochrome P450 oxidoreductase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF4
Reference
ACC
PmId
[9512878] Biosynthesis of the ansamycin antibiotic rifamycin: deductions from the molecular analysis of the rif biosynthetic gene cluster of Amycolatopsis mediterranei S699. (Chem Biol. , 1998)
[16079331] Identification of tailoring genes involved in the modification of the polyketide backbone of rifamycin B by Amycolatopsis mediterranei S699. (Microbiology. , 2005)
Related Reference
ACC
B3XWK3
PmId
[18640605] Increase in pladienolide D production rate using a Streptomyces strain overexpressing a cytochrome P450 gene. (J Biosci Bioeng. , 2008)

close this sectionSequence

selected fasta
>putative cytochrome P450 [putative cytochrome P450 oxidoreductase]
MTETVAFPQDRTCPYQPAPGYEPLADRRPIAEVTLYDGRKAWAVTGHELARKLLCDPRIS
SDRTNPAWPMVSAAAAVEFTDVQQKVIKLLTALVGVDGPAHRARRKLVQAGFTVKRIDSL
RPKIQALVDRQIDEMIAEGAPVDLLKKFASPVPLIALCDLLGIPHEDQDYFEKKAHQILF
GPDAGGAYDELMAYLTKLIDKAEQNPGEEGFLQALLAERDPSSDVDHEEILQMFLIVLVT
GHDTTSSSIGLGAFTLLQHPERLAELRADPSLMPAAVDELTRFVVVPDGLQRVAADDIEV
DADTTIRKGDGVFFLFSLINRDEEAYEDGDRLDWHRPTFRDHLTYGFGTHQCAGMNHARA
IMEIAFRRLIDRLPGLRLAVPADEVRVKPGDAFQGLAELPVTW
selected fasta
>putative cytochrome P450 [putative cytochrome P450 oxidoreductase]
TTGACGGAGACCGTCGCCTTCCCGCAAGACCGCACCTGCCCGTACCAGCCGGCGCCGGGT
TACGAACCGCTCGCCGACCGGCGCCCGATCGCCGAGGTCACCCTCTACGACGGCCGCAAG
GCCTGGGCGGTCACCGGGCACGAACTGGCCCGCAAGCTGCTGTGCGACCCGCGCATCTCC
AGTGACCGGACCAATCCCGCGTGGCCGATGGTCAGCGCGGCCGCGGCCGTCGAGTTCACC
GACGTCCAGCAGAAGGTCATCAAGCTGCTCACCGCGCTGGTGGGCGTCGACGGCCCGGCC
CACCGGGCGCGGCGCAAGCTGGTGCAGGCGGGGTTCACGGTCAAGCGGATCGACTCCCTG
CGGCCGAAGATCCAGGCGCTCGTCGACCGGCAGATCGACGAGATGATCGCCGAAGGCGCT
CCGGTGGACCTGCTCAAGAAGTTCGCTTCGCCGGTGCCCCTGATCGCGTTGTGCGATCTG
CTCGGCATCCCGCACGAGGACCAGGACTACTTCGAGAAGAAGGCGCACCAGATCCTGTTC
GGGCCGGACGCCGGCGGGGCCTACGACGAGCTGATGGCCTACCTGACGAAGCTGATCGAC
AAGGCCGAGCAGAACCCGGGCGAAGAGGGGTTCCTGCAGGCCCTGCTCGCCGAGCGCGAC
CCGTCGAGCGACGTGGACCACGAGGAAATCCTGCAGATGTTCCTCATCGTGCTGGTGACC
GGGCACGACACGACGTCGAGCTCGATCGGGCTCGGTGCCTTCACGCTGCTGCAGCACCCG
GAACGGCTGGCCGAGCTGCGGGCGGACCCGTCGCTGATGCCCGCCGCGGTGGACGAGCTG
ACCCGGTTCGTGGTCGTCCCCGACGGCCTGCAGCGGGTGGCCGCGGACGACATCGAGGTC
GACGCGGACACCACCATCCGCAAGGGCGACGGTGTGTTCTTCCTGTTCTCGCTCATCAAC
CGGGACGAGGAAGCCTACGAGGACGGCGACCGGCTGGATTGGCACCGCCCGACGTTCCGC
GACCACCTGACCTACGGGTTCGGGACGCACCAGTGCGCGGGGATGAACCACGCGCGCGCC
ATCATGGAAATCGCTTTCCGGCGGCTGATCGACCGGCTGCCGGGATTGCGCCTGGCGGTC
CCGGCCGACGAAGTCCGGGTCAAGCCGGGGGACGCGTTCCAAGGACTGGCCGAGCTGCCC
GTCACTTGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [12-403]  1.3e-87 G3DSA:1.10.630.10
G3DSA:1.10.630.10   no description
 [189-372]  4.5e-16 PF00067
PF00067   p450
 [6-403]  6.1e-81 SSF48264
SSF48264   Cytochrome P450
IPR002397 Cytochrome P450, B-class (Family)
 [96-107]  1.9e-27 PR00359 [143-159]  1.9e-27 PR00359 [160-175]  1.9e-27 PR00359 [193-215]  1.9e-27 PR00359 [275-286]  1.9e-27 PR00359 [321-336]  1.9e-27 PR00359 [343-352]  1.9e-27 PR00359 [352-363]  1.9e-27 PR00359
PR00359   BP450
SignalP No significant hit
TMHMM No significant hit