close all open/close all

CDS information : Rifam_00410


close this sectionLocation

Organism
StrainS699
Entry nameRifamycin
Contig
Start / Stop / Direction83,827 / 82,562 / - [in whole cluster]
83,827 / 82,562 / - [in contig]
Locationcomplement(82562..83827) [in whole cluster]
complement(82562..83827) [in contig]
TypeCDS
Length1,266 bp (421 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productcytochrome P450
Product (GenBank)putative cytochrome P450 monooxygenase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF5
Reference
ACC
PmId
[9512878] Biosynthesis of the ansamycin antibiotic rifamycin: deductions from the molecular analysis of the rif biosynthetic gene cluster of Amycolatopsis mediterranei S699. (Chem Biol. , 1998)
[16079331] Identification of tailoring genes involved in the modification of the polyketide backbone of rifamycin B by Amycolatopsis mediterranei S699. (Microbiology. , 2005)

close this sectionSequence

selected fasta
>cytochrome P450 [putative cytochrome P450 monooxygenase]
MTTTAETSAEPVDLFSPEVVADPWGAHAAVREAPTLQIGGFMGGPPMYLAARYEDVRQVL
MDQRFQCNPLADSPAEDIRNGVFRHLDMPEELIPWLKNLINASDGEEHARLRKLVSYALT
AHRVGKFRPRVEELTAELLDKLEAAGGDGTPIDLVESFCYPLPVTVICELVGVDHEDRPQ
WRAWSDAMATLDGKRLPEEVRKTLAAARGMIERRRAEPKDDMVTALVEAQAKNPGIATDD
ELVGVLFSLVTAGHQTTTYLIGNSVLALHEHPDQLARLKADPSLWPQAVRELQRLGPIQF
GQPRFATEDIEVGGTVIPRGMPVVPLIMAANSDPRKFPEPEKLQIDRLAVGSESHLGFGK
GIHRCLGQHVAYLEAEVALRGLYTRFPDMTLAVPREEIPWILRPGFTRTKDLPVRLARPA
S
selected fasta
>cytochrome P450 [putative cytochrome P450 monooxygenase]
ATGACCACCACTGCCGAGACTTCGGCCGAACCGGTCGACCTGTTCTCCCCGGAAGTGGTC
GCCGACCCGTGGGGAGCGCACGCGGCGGTCCGCGAGGCGCCGACGCTGCAGATCGGCGGC
TTCATGGGCGGGCCGCCGATGTACCTGGCCGCCCGCTACGAAGACGTCCGCCAGGTCCTG
ATGGACCAGCGGTTCCAGTGCAACCCGCTGGCCGATTCCCCCGCCGAGGACATCCGCAAC
GGCGTCTTCCGGCACCTGGACATGCCGGAGGAGCTGATCCCCTGGCTGAAGAACCTCATC
AACGCCTCCGACGGCGAGGAGCACGCCCGGCTGCGCAAGCTGGTCTCCTACGCGCTCACC
GCGCACCGGGTCGGCAAGTTCCGCCCCCGGGTCGAAGAGCTCACCGCGGAGCTGCTCGAC
AAGCTGGAAGCGGCGGGCGGTGACGGCACGCCGATCGACCTCGTCGAGTCGTTCTGCTAC
CCGCTGCCGGTCACCGTGATCTGCGAGCTGGTCGGCGTCGACCACGAAGACCGGCCGCAG
TGGCGTGCGTGGAGCGACGCGATGGCCACCCTGGACGGCAAGCGGCTCCCGGAAGAAGTG
CGCAAGACCCTCGCCGCCGCCCGCGGGATGATCGAGCGGCGCCGCGCCGAGCCGAAGGAC
GACATGGTCACCGCGCTCGTCGAGGCGCAGGCCAAGAACCCCGGCATCGCCACCGACGAC
GAGCTGGTCGGCGTCCTGTTCAGCCTGGTCACCGCCGGGCACCAGACGACCACCTACCTG
ATCGGCAACTCGGTGCTGGCCCTGCACGAGCACCCCGACCAGCTCGCGCGGCTCAAGGCC
GACCCGTCGCTGTGGCCGCAGGCCGTGCGCGAACTGCAGCGCCTGGGCCCGATCCAGTTC
GGGCAGCCGCGGTTCGCCACCGAGGACATCGAGGTGGGCGGCACGGTGATCCCGCGCGGC
ATGCCCGTGGTGCCGCTGATCATGGCCGCCAACAGCGACCCGCGGAAGTTCCCCGAGCCG
GAGAAGCTGCAGATCGACCGGCTCGCCGTCGGCAGCGAGAGCCACCTCGGCTTCGGCAAG
GGCATCCACCGCTGCCTCGGCCAGCACGTCGCCTACCTGGAGGCGGAAGTGGCCCTGCGC
GGCCTGTACACCCGGTTCCCGGACATGACGCTGGCGGTGCCGCGCGAAGAGATCCCGTGG
ATCCTGCGGCCCGGCTTCACCCGGACCAAGGACCTCCCGGTGCGGCTCGCCCGGCCGGCG
TCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [12-418]  1.2e-95 SSF48264
SSF48264   Cytochrome P450
 [12-417]  4.1e-101 G3DSA:1.10.630.10
G3DSA:1.10.630.10   no description
 [287-386]  5.6e-17 PF00067
PF00067   p450
IPR002397 Cytochrome P450, B-class (Family)
 [103-114]  1.6e-47 PR00359 [153-169]  1.6e-47 PR00359 [170-185]  1.6e-47 PR00359 [205-227]  1.6e-47 PR00359 [287-298]  1.6e-47 PR00359 [304-331]  1.6e-47 PR00359 [332-347]  1.6e-47 PR00359 [356-365]  1.6e-47 PR00359 [365-376]  1.6e-47 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [358-367]  PS00086
PS00086   CYTOCHROME_P450
SignalP
 [1-28]  0.145 Signal
Bacteria, Gram-negative   
 [1-28]  0.067 Signal
Eukaryota   
 [1-28]  0.149 Signal
Bacteria, Gram-positive   
TMHMM No significant hit