close all open/close all

CDS information : Rifam_00420


close this sectionLocation

Organism
StrainS699
Entry nameRifamycin
Contig
Start / Stop / Direction85,208 / 83,901 / - [in whole cluster]
85,208 / 83,901 / - [in contig]
Locationcomplement(83901..85208) [in whole cluster]
complement(83901..85208) [in contig]
TypeCDS
Length1,308 bp (435 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative pyridoxamine 5'-phosphate-dependent NDP-hexose C-3 dehydratase
Product (GenBank)putative dNTP-hexose dehydratase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF6
Reference
ACC
PmId
[9512878] Biosynthesis of the ansamycin antibiotic rifamycin: deductions from the molecular analysis of the rif biosynthetic gene cluster of Amycolatopsis mediterranei S699. (Chem Biol. , 1998)
Related Reference
ACC
Q9L4S6
NITE
Urd_00240
PmId
[11094336] The NDP-sugar co-substrate concentration and the enzyme expression level influence the substrate specificity of glycosyltransferases: cloning and characterization of deoxysugar biosynthetic genes of the urdamycin biosynthetic gene cluster. (Chem Biol. , 2000)
[17434221] Surprising production of a new urdamycin derivative by S. fradiae Delta urdQ/R. (J Biotechnol. , 2007)
ACC
Q9ALN8
NITE
Spino_00050
PmId
[17076492] Characterization of SpnQ from the spinosyn biosynthetic pathway of Saccharopolyspora spinosa: mechanistic and evolutionary implications for C-3 deoxygenation in deoxysugar biosynthesis. (J Am Chem Soc. , 2006)
[18345667] In vitro characterization of the enzymes involved in TDP-D-forosamine biosynthesis in the spinosyn pathway of Saccharopolyspora spinosa. (J Am Chem Soc. , 2008)

close this sectionSequence

selected fasta
>putative pyridoxamine 5'-phosphate-dependent NDP-hexose C-3 dehydratase [putative dNTP-hexose dehydratase]
MVDSARSDLLTQVRDYHDAQSPGPAPFIPGQTPILSSGAVLDAADREALVAAALDLRIAS
GTIATKFESSFARKLKRRKAVLTNSGSSANLLALSTLTSPTLGDEQLKPGDEVVTVAAGF
PTTVNPILQNGMIPVFVDIELGTYNTTAERVEAAISPRTRAIMIAHTLGNPFPVAEIAEI
AQRHGCHLIEDNCDAVGSTYQGQLTGTFGRFSTVSFYPAHHLTMGEGGMLLSSDIKLAKL
AKSFRDWGRDCWCEPGEDDRCLKRFDLHLGTLPEAYDHKYVFSEVGYNLKSTDIHAALGL
SQLAKLPDFVDARKRNWRQLREGLDGLPGLILPEATPGSDPSWFGFIITVKPDAGFDVPE
VVEYLEARNIRTRRLFAGNLTRHPAYIGKPQRIAGPLTNSDIVTERTFWIGVYPGITTEM
IEYVIGTLKEFVATH
selected fasta
>putative pyridoxamine 5'-phosphate-dependent NDP-hexose C-3 dehydratase [putative dNTP-hexose dehydratase]
ATGGTCGACTCAGCCCGATCGGACCTGCTGACGCAGGTTCGCGACTACCACGACGCCCAG
TCCCCCGGGCCGGCGCCGTTCATCCCGGGGCAGACACCGATCCTGTCGTCCGGGGCGGTG
CTGGACGCCGCCGACCGCGAAGCCCTGGTGGCCGCCGCGCTCGACCTGCGCATCGCCTCC
GGCACCATCGCGACGAAGTTCGAGTCGTCCTTCGCCCGGAAACTCAAGCGGCGCAAGGCG
GTGCTGACGAACTCCGGCTCGTCGGCGAACCTGCTGGCGCTGAGCACGCTGACGTCCCCG
ACGCTGGGCGACGAGCAGCTCAAGCCGGGCGACGAGGTCGTCACGGTCGCGGCCGGCTTC
CCGACCACGGTGAACCCGATCCTGCAGAACGGCATGATCCCGGTGTTCGTCGACATCGAG
CTCGGCACGTACAACACGACCGCCGAACGGGTCGAAGCGGCGATCTCCCCGCGCACGCGC
GCCATCATGATCGCCCACACGCTGGGAAATCCTTTCCCGGTGGCGGAAATCGCCGAAATC
GCCCAGCGCCACGGCTGCCACCTCATCGAGGACAACTGCGACGCCGTCGGCTCCACCTAC
CAGGGACAGCTCACCGGCACGTTCGGCCGGTTCTCGACGGTGTCCTTCTACCCAGCCCAC
CACCTGACCATGGGCGAGGGCGGCATGCTGCTGTCCTCGGACATCAAGCTGGCCAAGCTG
GCGAAGTCGTTCCGCGACTGGGGCCGCGACTGCTGGTGCGAGCCCGGCGAGGACGACCGC
TGCCTGAAGCGGTTCGACCTGCACCTCGGCACGCTGCCGGAGGCCTACGACCACAAGTAC
GTCTTCTCCGAGGTCGGCTACAACCTCAAGAGCACCGACATCCACGCCGCGCTCGGGCTG
AGCCAGCTGGCGAAACTGCCGGACTTCGTCGACGCCCGCAAGCGCAACTGGCGTCAGCTG
CGCGAAGGCCTCGACGGCCTGCCCGGGCTGATCCTGCCGGAGGCCACGCCGGGCAGCGAC
CCGAGCTGGTTCGGGTTCATCATCACGGTGAAACCCGACGCCGGCTTCGACGTCCCGGAG
GTCGTCGAGTACCTCGAGGCGCGCAACATCCGCACCCGGCGGCTGTTCGCGGGCAACCTG
ACCCGCCACCCCGCCTACATCGGCAAGCCGCAGCGCATCGCCGGCCCGCTGACCAACAGC
GACATCGTCACCGAGCGGACGTTCTGGATCGGCGTCTACCCGGGGATCACCACGGAGATG
ATCGAGTACGTGATCGGCACGCTCAAGGAGTTCGTCGCCACGCACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000653 DegT/DnrJ/EryC1/StrS aminotransferase (Family)
 [48-428]  7.4e-96 PF01041
PF01041   DegT_DnrJ_EryC1
IPR015421 Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (Domain)
 [37-304]  6.5e-69 G3DSA:3.40.640.10
G3DSA:3.40.640.10   no description
IPR015422 Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (Domain)
 [305-429]  2.1e-46 G3DSA:3.90.1150.10
G3DSA:3.90.1150.10   no description
IPR015424 Pyridoxal phosphate-dependent transferase, major domain (Domain)
 [31-435]  3.4e-96 SSF53383
SSF53383   PLP-dependent transferases
SignalP No significant hit
TMHMM No significant hit