close all open/close all

CDS information : Rifam_00430


close this sectionLocation

Organism
StrainS699
Entry nameRifamycin
Contig
Start / Stop / Direction85,411 / 86,556 / + [in whole cluster]
85,411 / 86,556 / + [in contig]
Location85411..86556 [in whole cluster]
85411..86556 [in contig]
TypeCDS
Length1,146 bp (381 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative glycosyltransferase
Product (GenBank)putative dNTP-hexose glycosyltransferase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF7
Reference
ACC
PmId
[9512878] Biosynthesis of the ansamycin antibiotic rifamycin: deductions from the molecular analysis of the rif biosynthetic gene cluster of Amycolatopsis mediterranei S699. (Chem Biol. , 1998)
Related Reference
ACC
Q9ZGC0
NITE
Lando_00200
PmId
[15977274] LanGT2 Catalyzes the First Glycosylation Step during landomycin A biosynthesis. (Chembiochem. , 2005)
[21513888] Rational design of an aryl-C-glycoside catalyst from a natural product O-glycosyltransferase. (Chem Biol. , 2011)
ACC
Q9RPA7
NITE
Urd_00200
PmId
[10658661] Two new tailoring enzymes, a glycosyltransferase and an oxygenase, involved in biosynthesis of the angucycline antibiotic urdamycin A in Streptomyces fradiae Tu2717. (Microbiology. , 2000)
[12696864] The C-Glycosyltransferase UrdGT2 is unselective toward d- and l-configured nucleotide-bound rhodinoses. (J Am Chem Soc. , 2003)
[17640665] Structure and action of the C-C bond-forming glycosyltransferase UrdGT2 involved in the biosynthesis of the antibiotic urdamycin. (J Mol Biol. , 2007)

close this sectionSequence

selected fasta
>putative glycosyltransferase [putative dNTP-hexose glycosyltransferase]
MKVLNLAGVAPSTVFSHVPLANALRNAGHQVMTTASVDEMVDTIAGVGLSAVRTTAPGVT
PRQVIAESGLTHVPEDPAEREVMAGRWYAHMEYVTLDALLAFSKDWRPDVIVSGVTSYSG
PLLAAHLGVPYVRHAWDIHTPRLMDQGAEDQLREQLTELGLDGLPEPAMTIEIAPPSLLP
DDLKGGQPMRWIPGNSQSVLEPWMYTKSAGTRIGVTIGTGVANYNQYDFLQAVVEQVATL
DAEVVVAVTEDAAPELRERLKNVRAGWIPLDVVAPTCDVLVHQTGGSTMMTGLSFGVPQV
LLPDPNLFRANAMARRLADTGAAVVLSPEEATSEVIAKTCGELVADPAFKAAAGGLAREI
AELPSPNEVALRIEQLVREAS
selected fasta
>putative glycosyltransferase [putative dNTP-hexose glycosyltransferase]
GTGAAGGTTCTAAATCTCGCCGGGGTCGCCCCGTCGACGGTGTTCAGCCACGTCCCGCTC
GCGAACGCCCTGCGCAACGCCGGGCACCAGGTGATGACCACGGCGTCGGTCGACGAGATG
GTCGACACGATCGCCGGCGTCGGGCTGTCCGCGGTGCGGACCACGGCGCCGGGCGTCACC
CCGCGGCAGGTCATCGCCGAAAGCGGCCTGACGCACGTGCCGGAAGACCCGGCAGAGCGC
GAAGTCATGGCCGGCCGCTGGTACGCGCACATGGAGTACGTGACCCTGGACGCCTTGCTG
GCGTTCAGCAAGGACTGGCGCCCGGACGTCATCGTCAGCGGCGTCACCTCCTACTCCGGC
CCGCTGCTGGCCGCCCACCTCGGCGTGCCGTACGTGCGCCACGCCTGGGACATCCACACC
CCGCGGCTGATGGATCAGGGTGCCGAGGACCAGCTGCGCGAGCAGCTGACGGAACTCGGC
CTGGACGGCCTGCCCGAGCCCGCCATGACGATCGAGATCGCGCCGCCGAGCCTGCTGCCG
GACGACCTCAAGGGCGGCCAGCCGATGCGGTGGATCCCCGGCAACTCGCAGTCGGTGCTG
GAACCGTGGATGTACACCAAGAGCGCGGGCACCCGGATCGGCGTCACCATCGGCACCGGG
GTCGCGAACTACAACCAGTACGACTTCCTGCAGGCCGTCGTCGAACAGGTCGCCACCCTG
GACGCCGAAGTCGTCGTGGCCGTCACCGAAGACGCGGCGCCGGAACTGCGTGAGCGGCTG
AAGAACGTGCGGGCGGGCTGGATCCCGCTGGACGTCGTCGCGCCGACCTGTGACGTCCTG
GTGCACCAGACCGGCGGCAGCACGATGATGACGGGCCTGAGCTTCGGCGTGCCGCAGGTG
CTGCTCCCGGACCCCAACCTCTTCCGCGCCAACGCGATGGCCCGCCGGCTCGCCGACACC
GGCGCCGCGGTCGTGCTCTCGCCCGAGGAAGCCACGAGCGAGGTCATCGCGAAGACGTGC
GGCGAGCTGGTCGCCGACCCGGCGTTCAAGGCGGCCGCGGGCGGGCTCGCCCGGGAGATC
GCCGAGCTGCCCTCGCCGAACGAAGTGGCGCTGCGCATCGAGCAGCTCGTCCGGGAAGCG
TCCTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004276 Glycosyl transferase, family 28 (Domain)
 [14-136]  4e-06 PF03033
PF03033   Glyco_transf_28
IPR010610 Domain of unknown function DUF1205 (Domain)
 [171-264]  2.2e-21 PF06722
PF06722   DUF1205
SignalP
 [1-21]  0.928 Signal
Bacteria, Gram-negative   
 [1-23]  0.828 Signal
Eukaryota   
 [1-23]  0.429 Signal
Bacteria, Gram-positive   
TMHMM No significant hit