close all open/close all

CDS information : Rifam_00440


close this sectionLocation

Organism
StrainS699
Entry nameRifamycin
Contig
Start / Stop / Direction86,563 / 87,207 / + [in whole cluster]
86,563 / 87,207 / + [in contig]
Location86563..87207 [in whole cluster]
86563..87207 [in contig]
TypeCDS
Length645 bp (214 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative NDP-hexose epimerase
Product (GenBank)putative dNTP-hexose 3,5-epimerase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF8
Reference
ACC
PmId
[9512878] Biosynthesis of the ansamycin antibiotic rifamycin: deductions from the molecular analysis of the rif biosynthetic gene cluster of Amycolatopsis mediterranei S699. (Chem Biol. , 1998)
Related Reference
ACC
Q9S0P2
NITE
Aver_00150
PmId
[11451669] Insights about the biosynthesis of the avermectin deoxysugar L-oleandrose through heterologous expression of Streptomyces avermitilis deoxysugar genes in Streptomyces lividans. (Chem Biol. , 2001)

close this sectionSequence

selected fasta
>putative NDP-hexose epimerase [putative dNTP-hexose 3,5-epimerase]
MGSVSTRSMTVQPLAIDGAHVVTSQSFGDERGDFFEVYRQDVLTEALGYRPRFLQTNVST
SCRNVVRGVHGAMTPPGLAKFVTCLRGSLLDFVVDVRTGSPTFGQWDMIVLNQHGGTAVY
VEEGLGHAFVSLEDDTCVQYLLSDLYRPAEVLTVQPLDPEIGLPLNLPGEPILSERDAAA
PTLREAGELGLLPRYEECLALREARVRLEVSVAS
selected fasta
>putative NDP-hexose epimerase [putative dNTP-hexose 3,5-epimerase]
ATGGGTAGCGTCAGCACCCGCAGCATGACCGTTCAGCCGCTGGCCATCGACGGCGCACAC
GTGGTCACGTCCCAGTCGTTCGGCGACGAGCGCGGCGACTTCTTCGAGGTCTACCGCCAG
GACGTGCTCACCGAGGCGCTCGGCTACCGGCCGCGGTTCCTGCAAACGAACGTCTCGACG
TCGTGCCGCAACGTCGTGCGCGGCGTGCACGGGGCGATGACCCCGCCCGGCCTGGCGAAG
TTCGTGACGTGCCTGCGCGGTTCGCTGCTCGACTTCGTCGTCGACGTGCGGACCGGTTCC
CCGACGTTCGGCCAGTGGGACATGATCGTGCTCAACCAGCACGGCGGGACCGCGGTGTAC
GTCGAGGAAGGCCTCGGCCACGCGTTCGTGTCCCTCGAAGACGACACGTGCGTCCAGTAC
CTGCTGTCCGACCTCTACCGGCCGGCGGAGGTGCTCACCGTGCAGCCGCTGGACCCGGAA
ATCGGCCTCCCGCTGAACCTGCCGGGCGAGCCGATCCTGTCCGAGCGCGACGCGGCGGCG
CCGACGTTGCGGGAGGCCGGCGAGCTGGGCCTGCTGCCGCGGTACGAGGAGTGCCTCGCG
CTGCGGGAGGCGCGCGTGCGGCTCGAAGTGTCCGTGGCTTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000888 dTDP-4-dehydrorhamnose 3,5-epimerase-related (Family)
 [12-185]  3e-51 PF00908
PF00908   dTDP_sugar_isom
 [14-186]  6e-98 PD001462
PD001462   O52564_AMYMD_O52564;
IPR011051 RmlC-like cupin domain (Domain)
 [9-190]  7.8e-64 SSF51182
SSF51182   RmlC-like cupins
IPR014710 RmlC-like jelly roll fold (Domain)
 [9-198]  1.6e-56 G3DSA:2.60.120.10
G3DSA:2.60.120.10   no description
SignalP No significant hit
TMHMM No significant hit