close all open/close all

CDS information : Rifam_00470


close this sectionLocation

Organism
StrainS699
Entry nameRifamycin
Contig
Start / Stop / Direction88,562 / 87,270 / - [in whole cluster]
88,562 / 87,270 / - [in contig]
Locationcomplement(87270..88562) [in whole cluster]
complement(87270..88562) [in contig]
TypeCDS
Length1,293 bp (430 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative aminotransferase
Product (GenBank)putative aminotransferase
Gene
Gene (GenBank)
EC number2.6.1.-
Keyword
Note
Note (GenBank)
  • ORF9
Reference
ACC
PmId
[9512878] Biosynthesis of the ansamycin antibiotic rifamycin: deductions from the molecular analysis of the rif biosynthetic gene cluster of Amycolatopsis mediterranei S699. (Chem Biol. , 1998)
[11278540] Mutational analysis and reconstituted expression of the biosynthetic genes involved in the formation of 3-amino-5-hydroxybenzoic acid, the starter unit of rifamycin biosynthesis in amycolatopsis Mediterranei S699. (J Biol Chem. , 2001)
[16079331] Identification of tailoring genes involved in the modification of the polyketide backbone of rifamycin B by Amycolatopsis mediterranei S699. (Microbiology. , 2005)
Related Reference
ACC
Q6JE91
PmId
[15184572] Rhodococcus opacus expresses the xsc gene to utilize taurine as a carbon source or as a nitrogen source but not as a sulfur source. (Microbiology. , 2004)

close this sectionSequence

selected fasta
>putative aminotransferase [putative aminotransferase]
MTVQKAPSQLLAAKLQIPPIPYSHAAGSWVYASDGTRYLDGASGIVNVNIGHAHPTVVAA
LRDQVGICTYASPGTFAPDLMEQLAAAAARAVHRPDDRVMFTPTGTHATESAIALARLVQ
RARGEEGRHKILTSTLGYHGNSAFVLALSGHRSRRPHEDDSFGLAPAFNPPYPGQHLGCP
FDACRVECVRAVRDAIVAAGPESVAAVLMEPVNGTTGGGYVPPAGYLRALREVCDEFGVL
VIHDEVLTGLGRCGLPLASHHTPGSAADIVTLSKGLGAGYVPLAATMLSPDLAEDIMTSG
KWLPLMGTMSATPLQGRAGLAVLSVLEELGALDRDEVRGAALGRLVADAVRGRQVVTDVR
GLGYFYGIELAPGTLGDVMRITRSRGLLLYPYVGFRPDRTGEGLLVAPRSTRPTAISASS
ARRWARHWTS
selected fasta
>putative aminotransferase [putative aminotransferase]
ATGACCGTGCAGAAAGCGCCGTCCCAGCTGCTGGCGGCCAAGCTGCAGATCCCCCCGATC
CCCTACAGCCACGCCGCCGGGTCCTGGGTGTACGCCTCCGACGGCACGCGCTACCTCGAC
GGCGCCAGCGGGATCGTCAACGTGAACATCGGCCACGCCCACCCCACGGTGGTCGCGGCC
CTGCGGGACCAGGTCGGGATCTGCACCTACGCCAGCCCCGGCACGTTCGCGCCCGACCTG
ATGGAGCAGCTGGCCGCGGCCGCCGCCCGGGCGGTGCACCGCCCGGACGACCGGGTGATG
TTCACCCCCACCGGCACGCACGCAACGGAATCCGCCATCGCGCTGGCCCGGCTGGTGCAG
CGGGCCCGCGGCGAAGAGGGCAGGCACAAGATCCTGACCTCGACGCTGGGCTACCACGGC
AACAGCGCGTTCGTGCTCGCCCTGTCGGGCCACCGGTCCCGGCGGCCGCACGAGGACGAC
AGCTTCGGCCTCGCTCCGGCGTTCAACCCGCCCTACCCCGGCCAGCACCTCGGCTGCCCG
TTCGACGCCTGCCGGGTCGAGTGCGTGCGCGCGGTGCGCGACGCGATCGTCGCGGCCGGC
CCGGAGAGCGTCGCCGCGGTGCTGATGGAGCCGGTCAACGGCACGACCGGCGGCGGGTAC
GTCCCGCCGGCGGGCTACCTGCGGGCGCTGCGCGAGGTCTGCGACGAGTTCGGCGTCCTC
GTCATCCACGACGAGGTCCTCACCGGGCTGGGCCGCTGCGGGCTCCCGCTGGCCTCGCAC
CACACGCCGGGTTCGGCGGCGGACATCGTCACGCTGTCGAAGGGCCTCGGCGCGGGGTAC
GTCCCGCTGGCGGCCACGATGCTCTCGCCGGACCTGGCCGAGGACATCATGACCAGCGGC
AAGTGGCTGCCGCTGATGGGCACGATGTCGGCGACCCCGCTGCAGGGCCGGGCCGGGCTG
GCGGTGCTTTCGGTGCTGGAGGAGCTCGGCGCCCTCGACCGCGACGAAGTCCGCGGCGCG
GCCCTCGGCCGGCTCGTGGCCGACGCCGTGCGCGGCCGGCAGGTGGTGACGGACGTCCGC
GGGCTCGGGTACTTCTACGGCATCGAGCTGGCTCCCGGCACGCTCGGCGACGTCATGCGG
ATCACCCGGAGCCGGGGCCTGCTGCTGTACCCGTACGTCGGCTTCCGCCCCGACCGCACG
GGCGAGGGCCTGCTGGTGGCCCCCCGCTCAACGCGACCGACGGCGATCTCGGCTTCCTCG
GCGAGACGCTGGGCGCGGCACTGGACCAGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005814 Aminotransferase class-III (Family)
 [241-279]  PS00600
PS00600   AA_TRANSFER_CLASS_3
 [22-371]  6e-65 PF00202
PF00202   Aminotran_3
IPR015421 Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (Domain)
 [55-328]  2.8e-61 G3DSA:3.40.640.10
G3DSA:3.40.640.10   no description
IPR015422 Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (Domain)
 [330-391]  1e-16 G3DSA:3.90.1150.10
G3DSA:3.90.1150.10   no description
IPR015424 Pyridoxal phosphate-dependent transferase, major domain (Domain)
 [18-429]  6.8e-86 SSF53383
SSF53383   PLP-dependent transferases
SignalP
 [1-25]  0.459 Signal
Bacteria, Gram-negative   
 [1-25]  0.494 Signal
Bacteria, Gram-positive   
TMHMM No significant hit