close all open/close all

CDS information : Rifam_00480


close this sectionLocation

Organism
StrainS699
Entry nameRifamycin
Contig
Start / Stop / Direction89,579 / 88,587 / - [in whole cluster]
89,579 / 88,587 / - [in contig]
Locationcomplement(88587..89579) [in whole cluster]
complement(88587..89579) [in contig]
TypeCDS
Length993 bp (330 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative NDP-hexose C-3 ketoreductase
Product (GenBank)putative dNTP-hexose 3-ketoreductase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF10
Reference
ACC
PmId
[9512878] Biosynthesis of the ansamycin antibiotic rifamycin: deductions from the molecular analysis of the rif biosynthetic gene cluster of Amycolatopsis mediterranei S699. (Chem Biol. , 1998)
[16079331] Identification of tailoring genes involved in the modification of the polyketide backbone of rifamycin B by Amycolatopsis mediterranei S699. (Microbiology. , 2005)
Related Reference
ACC
Q9ALN5
NITE
Spino_00080
PmId
[18345667] In vitro characterization of the enzymes involved in TDP-D-forosamine biosynthesis in the spinosyn pathway of Saccharopolyspora spinosa. (J Am Chem Soc. , 2008)

close this sectionSequence

selected fasta
>putative NDP-hexose C-3 ketoreductase [putative dNTP-hexose 3-ketoreductase]
MAPLRIGIMGCASIAVRKVLPAMAASPRTEITAIASRNPGKAAEIAHAYGCRAVEGYSAL
LDLDEVEAVYIPLPNAAHAGWIELALTAGKHVLAEKPLTTSVSRTCELIAAAGAAGLVLM
ENVMFLHHSQHTAVRDRLAGGAIGELRAFHAAFAVPARPAGDIRHRAELGGGALLDTGVY
PVRAAMSFLGSEVDVVSAVLTRRHGRPVDSAGQALLCTADGVSASATFGIDHAYRSGYEL
WGSEGRIVLDHAFTPPADHLPVVRLERRSGVDEIPLPPDDQVANTLTAFAAAVRSGRLPD
NDDVARQAVLVDDIRTKARLYVDHAPEPVG
selected fasta
>putative NDP-hexose C-3 ketoreductase [putative dNTP-hexose 3-ketoreductase]
GTGGCCCCACTGCGCATCGGGATCATGGGCTGCGCGAGCATCGCCGTCCGGAAGGTGCTT
CCCGCCATGGCCGCCTCGCCCCGCACGGAAATCACGGCGATCGCCAGCCGGAACCCCGGC
AAGGCCGCGGAAATCGCGCACGCCTACGGGTGCCGCGCGGTCGAGGGCTATTCGGCGCTG
CTGGACCTCGACGAGGTCGAGGCCGTCTACATCCCCCTGCCGAACGCCGCGCACGCGGGC
TGGATCGAGCTGGCGCTGACCGCCGGCAAGCACGTGCTGGCCGAGAAACCGTTGACCACC
AGCGTTTCCCGAACCTGTGAGCTGATCGCCGCGGCCGGTGCGGCCGGGCTCGTGCTGATG
GAGAACGTCATGTTCCTCCACCACAGCCAGCACACGGCGGTCCGGGACCGGCTGGCCGGC
GGCGCGATCGGCGAGCTGCGGGCGTTCCACGCCGCCTTCGCCGTGCCGGCCCGCCCAGCC
GGCGACATCCGCCACCGCGCCGAGCTCGGCGGCGGTGCGCTGCTGGACACCGGCGTCTAC
CCGGTGCGCGCGGCGATGTCCTTCCTGGGCAGCGAAGTCGACGTCGTTTCGGCGGTGCTC
ACCCGGCGCCACGGCCGGCCCGTCGACTCCGCCGGGCAGGCGCTGCTGTGCACCGCCGAC
GGGGTGAGCGCGTCCGCGACCTTCGGGATCGACCACGCCTACCGCTCCGGATACGAACTT
TGGGGCAGCGAAGGGCGGATCGTCCTCGACCACGCCTTCACCCCGCCCGCCGACCACCTC
CCCGTGGTCCGCCTCGAACGGCGTTCGGGCGTCGACGAAATCCCGCTGCCGCCCGACGAC
CAGGTGGCGAACACGCTCACCGCCTTCGCCGCGGCCGTCCGTTCGGGACGGCTGCCCGAC
AACGACGACGTGGCCCGCCAAGCCGTGCTCGTCGACGACATCCGCACCAAGGCGAGGCTT
TACGTCGATCACGCCCCCGAGCCGGTGGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000683 Oxidoreductase, N-terminal (Domain)
 [4-121]  2.6e-24 PF01408
PF01408   GFO_IDH_MocA
IPR004104 Oxidoreductase, C-terminal (Domain)
 [136-238]  4.6e-08 PF02894
PF02894   GFO_IDH_MocA_C
IPR016040 NAD(P)-binding domain (Domain)
 [1-145]  2.50000000000001e-40 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-24]  0.571 Signal
Bacteria, Gram-negative   
 [1-24]  0.673 Signal
Eukaryota   
 [1-24]  0.699 Signal
Bacteria, Gram-positive   
TMHMM No significant hit