close all open/close all

CDS information : Rifam_00490


close this sectionLocation

Organism
StrainS699
Entry nameRifamycin
Contig
Start / Stop / Direction89,646 / 90,611 / + [in whole cluster]
89,646 / 90,611 / + [in contig]
Location89646..90611 [in whole cluster]
89646..90611 [in contig]
TypeCDS
Length966 bp (321 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative flavin-dependent oxidoreductase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF11
Reference
ACC
PmId
[9512878] Biosynthesis of the ansamycin antibiotic rifamycin: deductions from the molecular analysis of the rif biosynthetic gene cluster of Amycolatopsis mediterranei S699. (Chem Biol. , 1998)
[16079331] Identification of tailoring genes involved in the modification of the polyketide backbone of rifamycin B by Amycolatopsis mediterranei S699. (Microbiology. , 2005)

close this sectionSequence

selected fasta
>hypothetical protein [putative flavin-dependent oxidoreductase]
MGIPRPDSARWWENRPDNRSDAWYFAVMATGRKPFRFGVDLITPAPRQAWVESCRKAEDL
GYDVIGVGDHLGMPAPFPALVLAAENTERVRLTTFVLNAGFHNPVLLAREVTGTDQLTGG
RFELGLGAGYVEAEFEAAGIPFPTARQRLEHLERTIEQLKKSYADPAHQPRPAQPSGPPL
LLGGRGNGLLTLAAAHADTIAFIGATASHKMLLADAAELADRVGFAKAALGPRAAEVELN
VFAHYIDVTADRRAGLEALHRRMPERTVDQLAELPTVLVGTAAQIAEQLETHRERYGFSY
FTVLEHNLEALAPVIDLLHGK
selected fasta
>hypothetical protein [putative flavin-dependent oxidoreductase]
GTGGGCATCCCTCGTCCTGATAGCGCTCGCTGGTGGGAAAACCGGCCGGACAACCGGTCC
GATGCTTGGTACTTTGCCGTTATGGCCACTGGGAGGAAGCCGTTCCGGTTCGGGGTCGAC
CTCATCACACCCGCACCGCGGCAGGCTTGGGTCGAAAGCTGCCGCAAGGCCGAGGATCTC
GGCTACGACGTCATCGGGGTGGGTGACCACCTGGGCATGCCGGCGCCGTTTCCGGCGCTG
GTGCTGGCCGCGGAGAACACCGAACGCGTCCGGCTCACGACGTTCGTGCTGAACGCCGGT
TTCCACAATCCCGTGCTGCTCGCGCGGGAAGTCACCGGCACCGACCAGCTCACCGGCGGC
CGGTTCGAACTCGGCCTCGGTGCGGGATACGTCGAAGCGGAATTCGAGGCCGCCGGAATT
CCCTTTCCGACAGCCCGGCAACGGCTCGAGCACCTGGAACGGACGATCGAGCAGCTCAAG
AAGAGCTACGCCGATCCGGCGCACCAGCCGCGGCCGGCGCAGCCGTCCGGCCCGCCGCTG
CTGCTGGGCGGGCGCGGGAACGGCCTGCTCACCCTGGCCGCCGCGCACGCGGACACCATC
GCGTTCATCGGCGCCACCGCTTCGCACAAGATGCTGCTGGCCGACGCCGCCGAGCTCGCC
GACCGGGTCGGGTTCGCCAAGGCCGCGCTCGGCCCGCGGGCGGCCGAGGTCGAACTGAAC
GTCTTCGCCCACTACATCGACGTCACCGCCGATCGCCGGGCCGGCCTGGAAGCATTACAC
CGGCGGATGCCCGAGCGCACGGTCGACCAGCTCGCCGAACTGCCGACCGTGCTCGTCGGC
ACCGCCGCGCAGATCGCCGAACAGCTCGAAACCCACCGGGAGCGCTACGGGTTCAGCTAC
TTCACCGTGCTCGAGCACAACCTCGAAGCGCTTGCCCCGGTCATCGATCTCCTGCACGGG
AAGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011251 Luciferase-like domain (Domain)
 [35-298]  4.70000000000003e-40 PF00296
PF00296   Bac_luciferase
 [36-305]  2.1e-47 G3DSA:3.20.20.30
G3DSA:3.20.20.30   Luciferase_like
 [33-319]  4.69998262513195e-49 SSF51679
SSF51679   Luciferase_like
IPR019923 Luciferase-like, F420-dependent oxidoreductase, MSMEG2516, predicted (Family)
 [35-318]  3.60000000000002e-101 TIGR03621
TIGR03621   F420_MSMEG_2516
SignalP No significant hit
TMHMM No significant hit