close all open/close all

CDS information : Rifam_00500


close this sectionLocation

Organism
StrainS699
Entry nameRifamycin
Contig
Start / Stop / Direction90,638 / 91,708 / + [in whole cluster]
90,638 / 91,708 / + [in contig]
Location90638..91708 [in whole cluster]
90638..91708 [in contig]
TypeCDS
Length1,071 bp (356 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)putative alpha-chain alkanal monooxygenase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF17
Reference
ACC
PmId
[16079331] Identification of tailoring genes involved in the modification of the polyketide backbone of rifamycin B by Amycolatopsis mediterranei S699. (Microbiology. , 2005)
Related Reference
ACC
P19839
PmId
[2204626] Nucleotide sequence, expression, and properties of luciferase coded by lux genes from a terrestrial bacterium. (J Biol Chem. , 1990)
[2383248] The nucleotide sequence of the luxA and luxB genes of Xenorhabdus luminescens HM and a comparison of the amino acid sequences of luciferases from four species of bioluminescent bacteria. (Biochem Biophys Res Commun. , 1990)
ACC
P07740
PmId
[3997817] Nucleotide sequence of the luxA gene of Vibrio harveyi and the complete amino acid sequence of the alpha subunit of bacterial luciferase. (J Biol Chem. , 1985)
[7756289] Three-dimensional structure of bacterial luciferase from Vibrio harveyi at 2.4 A resolution. (Biochemistry. , 1995)

close this sectionSequence

selected fasta
>putative oxidoreductase [putative alpha-chain alkanal monooxygenase]
MANRPMKFSTFHLFHQFAGMSAPEVYGYHVELVELLEELGFDGVWLAEHHFHDFGTVPNT
LTMLAHLAARTERLRLGTGIVVLPLRDPIHVAEEAAMVDLLSGGRLELGLGRGYQSIEFE
NFGLDLAESRDRFDECLDVLLGLFTTDDFEYRGRFQQTTHPLTLWPKPVQRPHPPLHVAA
ISPETVRKYAARGLPILADPAAPFARIAEAAETWHKTAAGHGVDAGDAELVASRVVYVAE
SDERAREEQARFEAAFDRTRVFLAGNAPIDLKTGGAARSYEYHLERLKDLSAEKDFAWNQ
LEVIGDPERVIGQIRSIQDMGYGNLLCDFGSTRQMPLEEMKKLLKFFAAEVMPAFR
selected fasta
>putative oxidoreductase [putative alpha-chain alkanal monooxygenase]
GTGGCGAACCGCCCGATGAAGTTCTCCACCTTCCACCTCTTCCACCAGTTCGCCGGGATG
AGCGCGCCGGAGGTCTACGGCTACCACGTCGAGCTCGTCGAGCTGCTGGAGGAGCTCGGC
TTCGACGGCGTGTGGCTGGCCGAGCACCACTTCCACGACTTCGGCACCGTGCCGAACACG
CTCACCATGCTCGCCCACCTGGCGGCCCGCACCGAACGGCTGCGGCTCGGCACCGGGATC
GTGGTGCTGCCGCTGCGCGACCCGATCCACGTGGCCGAGGAGGCCGCGATGGTGGACCTG
CTCTCCGGCGGCCGGCTCGAGCTGGGCCTCGGCCGCGGCTACCAGAGCATCGAGTTCGAG
AACTTCGGGCTCGACCTCGCCGAATCCCGCGACCGGTTCGACGAGTGCCTCGACGTGCTG
CTCGGCCTCTTCACCACGGACGATTTCGAGTACCGGGGCCGGTTCCAGCAGACCACCCAC
CCGCTGACGCTGTGGCCCAAGCCGGTGCAGCGGCCGCACCCGCCGCTGCACGTCGCCGCC
ATCAGCCCCGAGACCGTGCGGAAGTACGCCGCCCGCGGCCTGCCGATCCTGGCCGACCCG
GCTGCTCCTTTCGCGCGGATCGCCGAGGCCGCGGAGACCTGGCACAAGACCGCCGCCGGC
CACGGCGTCGACGCGGGGGATGCCGAACTCGTCGCCAGCCGCGTGGTGTACGTCGCCGAG
TCCGACGAGCGGGCCCGCGAAGAGCAGGCCCGGTTCGAGGCGGCGTTCGACCGGACCCGG
GTCTTCCTGGCGGGCAACGCGCCGATCGACCTGAAGACCGGCGGGGCCGCGAGGAGCTAC
GAGTACCACCTGGAACGGCTCAAGGACCTCTCGGCCGAGAAGGACTTCGCCTGGAACCAG
CTGGAAGTCATCGGCGACCCCGAGCGCGTCATCGGGCAGATCCGGTCCATTCAGGACATG
GGCTACGGCAACCTCCTGTGCGACTTCGGCTCGACGCGGCAGATGCCGCTCGAGGAGATG
AAGAAGCTGCTGAAGTTCTTCGCCGCCGAGGTCATGCCCGCGTTCCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011251 Luciferase-like domain (Domain)
 [6-356]  8.99992502689852e-92 SSF51679
SSF51679   Luciferase_like
 [6-322]  2.90000000000003e-73 PF00296
PF00296   Bac_luciferase
 [6-356]  1.9e-96 G3DSA:3.20.20.30
G3DSA:3.20.20.30   Luciferase_like
SignalP
 [1-27]  0.33 Signal
Eukaryota   
TMHMM No significant hit