close all open/close all

CDS information : Rifam_00510


close this sectionLocation

Organism
StrainS699
Entry nameRifamycin
Contig
Start / Stop / Direction91,789 / 93,210 / + [in whole cluster]
91,789 / 93,210 / + [in contig]
Location91789..93210 [in whole cluster]
91789..93210 [in contig]
TypeCDS
Length1,422 bp (473 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative NDP-hexose 2,3-dehydratase
Product (GenBank)putative 2,3-dehydratase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF18
Reference
ACC
PmId
[16079331] Identification of tailoring genes involved in the modification of the polyketide backbone of rifamycin B by Amycolatopsis mediterranei S699. (Microbiology. , 2005)
Related Reference
ACC
Q9ALN6
NITE
Spino_00070
PmId
[18345667] In vitro characterization of the enzymes involved in TDP-D-forosamine biosynthesis in the spinosyn pathway of Saccharopolyspora spinosa. (J Am Chem Soc. , 2008)

close this sectionSequence

selected fasta
>putative NDP-hexose 2,3-dehydratase [putative 2,3-dehydratase]
MVHSAIHEDTARDGRSDAVADDAVMSMADFHSWFNARARANRFQVDRIPFLELSGWDFEP
DTGNLVHASGRFFSVEGLRVRTDRPWVSEWAQPIIVQPEIGVLGILVKRFDGVPHCLMQA
KMEPGNINGLQISPTVQATRSNYMKVHGGAATKYMEYFRPGSRGRVLFDGLQSEQGSWFL
HKRNRNIVVETDDDVPLDEDFCWLTLDQIRRLLRLDHMVNMDSRTVLACVPPALARPDDR
TTGDGSFVEAVHRSLSGRGRAVHDPGHILSWLTEVRARQELVQRRVPLKEIVEDGWRLGH
DVIDHRDGKYFDVVAVAVEASNREVTAWTQPLVAPRQSGLLALLVKRIGGTLHALVQARS
DAGTLNIAELTATVHCQPGNYADAPAEYRPPYLDYALAAATGRVRLDVVHSEEGGRFYHA
QNRYLVIEVEDDFAAEPDDRFLWTTLNQLMSLLSHSNYLTVELRSLMAGMRSF
selected fasta
>putative NDP-hexose 2,3-dehydratase [putative 2,3-dehydratase]
GTGGTCCACAGCGCGATACACGAGGACACGGCACGGGACGGACGCTCCGACGCCGTGGCC
GACGACGCGGTCATGTCCATGGCGGACTTCCACTCCTGGTTCAACGCGCGAGCACGCGCG
AACCGCTTCCAGGTGGACCGGATTCCGTTCCTGGAGCTGTCCGGCTGGGACTTCGAGCCG
GACACGGGCAACCTGGTGCACGCCAGCGGCCGGTTCTTCTCGGTCGAGGGCCTGCGCGTC
CGGACCGACCGGCCCTGGGTGAGCGAGTGGGCCCAGCCGATCATCGTGCAGCCGGAGATC
GGCGTGCTCGGCATCCTCGTCAAGCGGTTCGACGGGGTCCCGCACTGCCTGATGCAGGCG
AAGATGGAGCCGGGCAACATCAACGGCCTGCAGATCTCGCCGACCGTGCAGGCCACGCGC
AGCAACTACATGAAGGTCCACGGCGGCGCGGCCACCAAGTACATGGAGTACTTCCGGCCC
GGCTCCCGCGGCCGCGTGCTGTTCGACGGGCTGCAGTCCGAGCAGGGGTCGTGGTTCCTG
CACAAGCGCAACCGCAACATCGTCGTCGAGACCGACGACGACGTCCCGCTGGACGAGGAC
TTCTGCTGGCTGACGCTCGACCAGATCCGGCGCCTGCTGCGGCTGGACCACATGGTGAAC
ATGGACTCCCGGACGGTTCTCGCGTGCGTCCCGCCCGCCTTGGCGCGGCCCGACGACCGG
ACGACCGGCGACGGCTCGTTCGTCGAAGCGGTCCACCGTTCGCTCTCGGGCCGCGGCCGG
GCCGTGCACGACCCGGGCCACATCCTCAGCTGGCTCACCGAGGTGCGCGCCCGCCAGGAG
CTGGTGCAGCGCCGGGTGCCGCTCAAGGAGATCGTCGAAGACGGCTGGCGGCTCGGTCAC
GACGTCATCGACCACCGCGACGGCAAGTACTTCGACGTCGTCGCGGTGGCCGTGGAAGCC
AGCAACCGCGAGGTCACCGCGTGGACCCAGCCGCTGGTGGCGCCCCGGCAGTCCGGCCTG
CTCGCGTTGCTGGTCAAGCGGATCGGCGGCACGCTGCACGCTCTGGTGCAGGCCCGCAGT
GACGCGGGCACGCTCAACATCGCCGAGCTCACCGCGACGGTGCACTGCCAGCCCGGCAAC
TACGCCGACGCGCCGGCGGAGTACCGCCCGCCCTACCTCGACTACGCGCTGGCCGCCGCC
ACCGGACGCGTCCGGCTGGACGTGGTGCATTCCGAGGAAGGCGGCCGGTTCTACCACGCG
CAGAACCGCTACCTGGTGATCGAGGTCGAGGACGACTTCGCCGCCGAGCCGGACGACCGG
TTCCTCTGGACCACGCTGAACCAGCTGATGTCGCTGCTGTCGCACAGCAACTACCTGACG
GTGGAACTGCGGAGCCTGATGGCGGGCATGCGCAGCTTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005212 NDP-hexose 2,3-dehydratase (Domain)
 [26-230]  8.9e-87 PF03559 [266-469]  2.5e-77 PF03559
PF03559   Hexose_dehydrat
SignalP No significant hit
TMHMM No significant hit