close all open/close all

CDS information : Rifam_00520


close this sectionLocation

Organism
StrainS699
Entry nameRifamycin
Contig
Start / Stop / Direction94,810 / 93,305 / - [in whole cluster]
94,810 / 93,305 / - [in contig]
Locationcomplement(93305..94810) [in whole cluster]
complement(93305..94810) [in contig]
TypeCDS
Length1,506 bp (501 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative hydroxylase
Product (GenBank)putative 3-(3-hydroxylphenyl) propionate hydroxylase
Gene
Gene (GenBank)
EC number
Keyword
  • naphthalene ring formation
Note
Note (GenBank)
  • ORF19
Reference
ACC
PmId
[10430893] Direct evidence that the rifamycin polyketide synthase assembles polyketide chains processively. (Proc Natl Acad Sci U S A. , 1999)
[16079331] Identification of tailoring genes involved in the modification of the polyketide backbone of rifamycin B by Amycolatopsis mediterranei S699. (Microbiology. , 2005)
Related Reference
ACC
Q84G20
NITE
Gelda2_00120
PmId
[16085885] Insights into the biosynthesis of the benzoquinone ansamycins geldanamycin and herbimycin, obtained by gene sequencing and disruption. (Appl Environ Microbiol. , 2005)
ACC
P77397
PmId
[9603882] Characterization of the hca cluster encoding the dioxygenolytic pathway for initial catabolism of 3-phenylpropionic acid in Escherichia coli K-12. (J Bacteriol. , 1998)

close this sectionSequence

selected fasta
>putative hydroxylase [putative 3-(3-hydroxylphenyl) propionate hydroxylase]
MTDTDVVIVGNGPIGATLSVLLAQRGWRVTVLERRPRPYKLPRATSFDGETARLLAATGI
GPDLGRITAPANGYQWQTADGQTLLDIAFTTDGPYGWPDANTMHQPALEELLAARAADLP
GITVLRGHEVVAITDGDSFVQVTATGEDDVPRTISGRWVVGCDGANSFVREHLDVPVTDL
GFSYEWLLCDVRLNEPREFVPTNVQICDPARPTTLVGSGPGRRRWEFMRLPGENAAELNK
DETAWRLMAPFGVTPETATLLRSTTYIFQARWADRWRVGHVLLAGDAAHLMPPFAGQGMC
SGIRDVTNLAWKLDLTLRGLAPESLLDSYGDERREQAREAILASVQLGRVICVTDPAAAA
ERDSTVLANRRGKPAGRPEPAKPLTGGLRHESPGAGVVVPQGRVQVGDATGLFDDVIGRG
FVLLTTEETHSDFLTELGAHVVRLDEGVDVDDVYRPFLARFGAASVLVRPDYHVFGTAGP
GGLEALVGALRDRLRAAVPTG
selected fasta
>putative hydroxylase [putative 3-(3-hydroxylphenyl) propionate hydroxylase]
TTGACGGACACGGACGTCGTCATCGTCGGAAACGGCCCGATCGGCGCCACGCTGTCGGTG
CTGCTCGCGCAACGCGGTTGGCGGGTGACGGTGCTCGAACGCCGGCCCCGGCCGTACAAG
CTGCCGCGGGCGACCAGCTTCGACGGCGAGACGGCCCGGCTGCTGGCCGCCACCGGCATC
GGCCCGGACCTCGGCCGGATCACCGCGCCGGCCAACGGCTACCAGTGGCAGACCGCCGAC
GGGCAGACGCTGCTCGACATCGCCTTCACCACAGACGGCCCGTACGGCTGGCCGGACGCC
AACACCATGCACCAGCCCGCGCTCGAGGAGCTCCTCGCGGCCCGGGCGGCGGACCTGCCC
GGGATCACCGTGCTGCGCGGGCACGAAGTCGTGGCCATCACCGACGGCGACTCGTTCGTC
CAGGTGACCGCCACCGGCGAAGACGACGTTCCGCGGACGATCTCGGGCCGGTGGGTGGTC
GGCTGCGACGGTGCCAACAGCTTCGTGCGCGAGCACCTCGACGTGCCGGTGACCGACCTC
GGCTTCTCCTACGAGTGGCTACTCTGCGACGTCCGGCTGAACGAGCCGCGCGAGTTCGTG
CCGACGAACGTGCAGATCTGCGACCCGGCCCGGCCCACCACGCTGGTGGGCAGCGGGCCC
GGCCGCCGTCGCTGGGAGTTCATGCGCCTGCCGGGCGAAAACGCGGCGGAGCTCAACAAG
GACGAGACGGCGTGGCGGCTGATGGCCCCCTTCGGCGTCACCCCCGAAACCGCCACCCTG
CTGCGCAGCACCACCTACATCTTCCAGGCCCGCTGGGCCGACCGGTGGCGGGTGGGGCAC
GTCCTGCTCGCCGGCGACGCGGCGCACCTGATGCCGCCGTTCGCCGGGCAGGGCATGTGC
TCCGGCATCCGCGACGTCACCAACCTGGCGTGGAAGCTCGACCTCACGCTCCGCGGCTTG
GCTCCGGAGTCCCTTTTGGACAGCTACGGGGACGAGCGGCGCGAGCAGGCGCGCGAGGCC
ATCCTCGCGTCGGTCCAGCTGGGCCGGGTGATCTGCGTGACGGACCCGGCGGCCGCCGCC
GAGCGGGACTCGACCGTGCTGGCCAACCGCCGCGGCAAGCCCGCGGGCCGGCCGGAACCG
GCGAAGCCGCTCACCGGCGGGCTGCGCCACGAAAGCCCGGGCGCGGGCGTGGTGGTGCCG
CAGGGCCGGGTGCAGGTCGGCGACGCCACCGGGCTCTTCGACGACGTCATCGGCCGGGGT
TTCGTCCTGCTGACCACCGAGGAGACCCACTCGGACTTCCTCACCGAACTCGGAGCCCAC
GTCGTCCGGCTCGACGAGGGGGTGGACGTCGACGACGTCTACCGGCCGTTCCTGGCCCGG
TTCGGGGCGGCTTCGGTGCTCGTGCGGCCGGACTACCACGTCTTCGGCACGGCCGGGCCG
GGCGGGCTCGAAGCCCTGGTCGGCGCCCTGCGCGACCGGCTGCGCGCCGCGGTGCCCACC
GGCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002938 Monooxygenase, FAD-binding (Domain)
 [3-341]  9e-61 PF01494
PF01494   FAD_binding_3
IPR003042 Aromatic-ring hydroxylase-like (Domain)
 [5-27]  8.2e-33 PR00420 [155-170]  8.2e-33 PR00420 [278-293]  8.2e-33 PR00420 [293-309]  8.2e-33 PR00420 [311-329]  8.2e-33 PR00420 [329-345]  8.2e-33 PR00420
PR00420   RNGMNOXGNASE
SignalP No significant hit
TMHMM No significant hit