close all open/close all

CDS information : Rifam_00530


close this sectionLocation

Organism
StrainS699
Entry nameRifamycin
Contig
Start / Stop / Direction96,037 / 94,826 / - [in whole cluster]
96,037 / 94,826 / - [in contig]
Locationcomplement(94826..96037) [in whole cluster]
complement(94826..96037) [in contig]
TypeCDS
Length1,212 bp (403 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
ProductC-25 O-acetyltransferase
Product (GenBank)putative polyketide associated protein
Gene
Gene (GenBank)
EC number2.3.1.-
Keyword
Note
Note (GenBank)
  • ORF20
Reference
ACC
PmId
[16079331] Identification of tailoring genes involved in the modification of the polyketide backbone of rifamycin B by Amycolatopsis mediterranei S699. (Microbiology. , 2005)
[15791687] A homologue of the Mycobacterium tuberculosis PapA5 protein, rif-orf20, is an acetyltransferase involved in the biosynthesis of antitubercular drug rifamycin B by Amycolatopsis mediterranei S699. (Chembiochem. , 2005)

close this sectionSequence

selected fasta
>C-25 O-acetyltransferase [putative polyketide associated protein]
MTRAAVRRALAPSESIHAVKEAYIGYTVRAEGRLDPEALTTAFEAVTRAYPQLSACVEFT
GEGAVLAESDARPEIRFADGDPGRPLEGLDLDQSRSLSALNVVRDGDEASVCLAIQHSVA
DAHHATAILSALWSCYTDVIEGVPLDLGRHPYPRSLEDLLAERGIHASVPAAPSVPPAAP
PPASRPDPVIRHVVQHRLTEAETTALAELGHREKVTINGLVSGAVLLAEAEIRDLPLTDL
VYRYSVNLRSRLTPPVGATEGTNVLDGVGFKVTDGIAHDAVAIGRAIGEQLRAGLADGSV
QRSILDMFARPAAAKPWDPKLALAVVSIMNWGVAPPMRTPDGLRLTNLHSASRMRETLAL
GGYVMSSFGGRVGLDVGWPEGDPSLPQRLDCLRERLARLTRDL
selected fasta
>C-25 O-acetyltransferase [putative polyketide associated protein]
GTGACGCGAGCGGCTGTCCGGCGCGCGCTGGCGCCCAGCGAGAGCATCCACGCCGTGAAA
GAGGCCTACATCGGGTACACCGTGCGTGCCGAGGGCCGGCTCGACCCCGAGGCGCTGACG
ACCGCGTTCGAAGCGGTCACTCGCGCCTACCCCCAGCTTTCGGCCTGCGTGGAGTTCACC
GGCGAGGGCGCGGTGCTCGCCGAGTCCGACGCGCGGCCGGAGATCCGGTTCGCCGACGGC
GATCCCGGCCGGCCACTCGAGGGATTGGACCTCGACCAGAGCCGTTCGCTGAGCGCGCTC
AACGTCGTCCGCGACGGCGACGAAGCCAGTGTCTGCCTGGCGATCCAGCACAGTGTCGCC
GACGCCCACCACGCCACCGCGATCCTCTCGGCGCTCTGGTCCTGCTACACCGACGTCATC
GAGGGCGTGCCGCTCGACCTGGGCCGGCACCCGTACCCGCGGTCGCTGGAGGACCTGCTG
GCCGAACGCGGCATCCACGCGAGCGTCCCGGCGGCGCCCTCGGTCCCACCGGCGGCACCG
CCGCCCGCGTCCCGGCCGGACCCCGTCATCCGGCACGTCGTCCAGCACCGGCTGACCGAA
GCCGAAACGACGGCGCTGGCGGAACTCGGCCACCGGGAGAAGGTGACGATCAACGGCCTG
GTGTCGGGCGCGGTCCTGCTCGCCGAGGCCGAGATCCGTGACCTCCCGCTGACCGACCTC
GTCTACCGGTACTCGGTGAACCTGCGCAGCAGGCTGACGCCCCCGGTCGGCGCGACCGAG
GGCACGAACGTGCTGGACGGGGTCGGGTTCAAGGTGACGGACGGGATCGCGCACGACGCC
GTCGCGATCGGCCGGGCCATCGGCGAGCAGCTGCGGGCCGGCCTCGCCGACGGGTCCGTG
CAGCGCAGCATCCTGGACATGTTCGCCCGGCCCGCCGCCGCGAAACCGTGGGACCCGAAG
CTCGCCCTCGCCGTGGTCAGCATCATGAACTGGGGCGTCGCCCCGCCGATGCGCACGCCG
GACGGCCTGCGGCTGACCAACCTGCACTCGGCGTCGCGGATGCGGGAAACCCTCGCGCTC
GGCGGTTACGTGATGAGCAGCTTCGGCGGCCGGGTGGGCCTCGACGTGGGCTGGCCCGAG
GGCGATCCTTCGCTGCCGCAGCGGCTGGACTGCCTGCGCGAACGGCTGGCCCGCCTGACT
CGTGACCTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit