close all open/close all

CDS information : Rifam_00550


close this sectionLocation

Organism
StrainS699
Entry nameRifamycin
Contig
Start / Stop / Direction98,101 / 96,833 / - [in whole cluster]
98,101 / 96,833 / - [in contig]
Locationcomplement(96833..98101) [in whole cluster]
complement(96833..98101) [in contig]
TypeCDS
Length1,269 bp (422 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative cytochrome P450
Product (GenBank)putative cytochrome P450 monooxygenase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF13
Reference
ACC
PmId
[9512878] Biosynthesis of the ansamycin antibiotic rifamycin: deductions from the molecular analysis of the rif biosynthetic gene cluster of Amycolatopsis mediterranei S699. (Chem Biol. , 1998)
[16079331] Identification of tailoring genes involved in the modification of the polyketide backbone of rifamycin B by Amycolatopsis mediterranei S699. (Microbiology. , 2005)
Related Reference
ACC
O52561
NITE
Rifam_00410
PmId
[16079331] Identification of tailoring genes involved in the modification of the polyketide backbone of rifamycin B by Amycolatopsis mediterranei S699. (Microbiology. , 2005)

close this sectionSequence

selected fasta
>putative cytochrome P450 [putative cytochrome P450 monooxygenase]
MTATAKPSAKPVDLFSPEVVADPFGWYARLREEPLPHTGTLNLGTMMGGPDMWLATRYED
VLTVLTDPRFLTNPPADSPLADIRDGVFKAMNFPEDLIPWMANKLNTADGEDHTRLRKLV
SYALTARRVNALRPRVEKITEDLFDRMAEQGKDGSPVDIVEEFCFPLPVTVICELVGIDE
PDRAAWHAWGNAMATMDGPKIPPALRECIALSRELMARRRVEPKDDLVTALVQAQADDPG
RVSDDEIVGILFSLVTAGHQTTTYLIGNSVLFLLEQPEQLARLKAEPALWAQAVRELQRL
GPLQFTQARFPSEDVELGGVTIPRGTPVAPLLLAANTDPRKFPEPDKLVVDRLSVANEMH
LSFGKGIHRCLGQHLAYQEAEVALHGLFTRFPDLALAVPRDEIPWILRPAFTRTKTLPLK
LA
selected fasta
>putative cytochrome P450 [putative cytochrome P450 monooxygenase]
ATGACCGCCACCGCCAAGCCTTCGGCCAAGCCGGTCGACCTGTTCTCACCGGAAGTGGTC
GCCGACCCGTTCGGCTGGTACGCGCGGTTGCGCGAAGAACCGTTGCCGCACACCGGGACG
CTGAACCTCGGCACCATGATGGGCGGGCCGGACATGTGGCTGGCCACCCGCTACGAGGAC
GTGCTCACGGTCCTCACCGACCCGCGCTTCCTCACCAACCCGCCCGCGGACTCGCCCCTG
GCCGACATCCGCGACGGCGTCTTCAAGGCGATGAACTTCCCCGAAGACCTCATCCCGTGG
ATGGCCAACAAGCTCAACACCGCCGACGGCGAGGACCACACCCGGCTGCGCAAGCTGGTC
TCGTACGCGCTGACCGCGCGCCGCGTCAACGCGCTGCGGCCGCGCGTCGAGAAGATCACC
GAGGACCTGTTCGACCGGATGGCGGAACAGGGCAAGGACGGGTCGCCGGTCGACATCGTC
GAGGAGTTCTGCTTCCCGCTGCCGGTGACGGTCATCTGCGAGCTGGTCGGCATCGACGAA
CCCGACCGCGCGGCCTGGCACGCCTGGGGCAACGCGATGGCGACCATGGACGGGCCGAAG
ATCCCGCCCGCGCTGCGCGAGTGCATCGCCCTCTCGCGCGAGCTGATGGCCCGACGGCGC
GTCGAGCCGAAGGACGACCTGGTCACCGCCCTGGTGCAAGCCCAGGCCGACGACCCGGGC
CGGGTGTCCGACGACGAGATCGTCGGCATCCTGTTCAGCCTCGTCACGGCCGGGCACCAG
ACGACGACCTACCTGATCGGGAACTCGGTGCTCTTCCTGCTCGAGCAGCCGGAGCAGCTC
GCGCGGCTGAAGGCCGAGCCGGCGCTGTGGGCGCAGGCCGTGCGCGAGCTGCAGCGCCTG
GGCCCGCTGCAGTTCACGCAGGCCCGCTTCCCGTCCGAGGACGTCGAGCTCGGTGGCGTC
ACGATCCCGCGGGGGACGCCGGTCGCGCCGCTGCTGCTGGCCGCCAACACCGACCCGCGC
AAGTTCCCGGAGCCGGACAAGCTGGTCGTCGACCGGCTGAGCGTCGCCAACGAGATGCAC
CTTTCGTTCGGCAAGGGCATCCACCGCTGCCTGGGCCAGCACCTCGCCTACCAGGAGGCC
GAGGTGGCGCTGCACGGGCTGTTCACCCGGTTCCCGGACCTGGCTCTGGCCGTGCCGCGC
GACGAGATCCCGTGGATCCTCCGGCCGGCGTTCACCCGGACCAAGACGCTCCCCCTGAAG
CTCGCTTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [257-274]  1.60000065022528e-05 PR00385 [292-303]  1.60000065022528e-05 PR00385 [361-370]  1.60000065022528e-05 PR00385 [370-381]  1.60000065022528e-05 PR00385
PR00385   P450
 [8-421]  9.69999999999989e-100 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [10-421]  2.7000136937899e-92 SSF48264
SSF48264   Cytochrome_P450
 [219-391]  4.2e-22 PF00067
PF00067   p450
IPR002397 Cytochrome P450, B-class (Family)
 [108-119]  1.40000506907309e-43 PR00359 [158-174]  1.40000506907309e-43 PR00359 [175-190]  1.40000506907309e-43 PR00359 [210-232]  1.40000506907309e-43 PR00359 [292-303]  1.40000506907309e-43 PR00359 [309-336]  1.40000506907309e-43 PR00359 [337-352]  1.40000506907309e-43 PR00359 [361-370]  1.40000506907309e-43 PR00359 [370-381]  1.40000506907309e-43 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [363-372]  PS00086
PS00086   CYTOCHROME_P450
SignalP
 [1-21]  0.24 Signal
Bacteria, Gram-negative   
TMHMM No significant hit