close all open/close all

CDS information : Rifam_00560


close this sectionLocation

Organism
StrainS699
Entry nameRifamycin
Contig
Start / Stop / Direction98,368 / 99,186 / + [in whole cluster]
98,368 / 99,186 / + [in contig]
Location98368..99186 [in whole cluster]
98368..99186 [in contig]
TypeCDS
Length819 bp (272 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
ProductC-27 O-methyltransferase
Product (GenBank)C-27 O-methyltransferase
Gene
Gene (GenBank)
EC number2.1.1.-
Keyword
Note
Note (GenBank)
  • ORF14
Reference
ACC
PmId
[9512878] Biosynthesis of the ansamycin antibiotic rifamycin: deductions from the molecular analysis of the rif biosynthetic gene cluster of Amycolatopsis mediterranei S699. (Chem Biol. , 1998)
[12623077] Isolation and characterization of 27-O-demethylrifamycin SV methyltransferase provides new insights into the post-PKS modification steps during the biosynthesis of the antitubercular drug rifamycin B by Amycolatopsis mediterranei S699. (Arch Biochem Biophys. , 2003)

close this sectionSequence

selected fasta
>C-27 O-methyltransferase [C-27 O-methyltransferase]
MTKPTPNEIGKGYDAFADLLDQFWGENLHHGYWDDESATLEEATTRLTDRLAGMLPLRAG
DRLLDIGCGNGEPAIRMATANDVMVTGISISEKQVERANDRAYKADVDDRVVFEYADAME
LPYPDASFDVVWALESLHHMPDRWHVIRQAARVLRPGGRLALGDFLLVPSPAGLEADAER
VREVGKGVVAVVSLDEYQAHLREAGLEPESAEDVSQYTRPSWTKAAERFEGLREQALQHI
EAAQFEVTLGRFRAFSEEPSLGYVLLTARKPD
selected fasta
>C-27 O-methyltransferase [C-27 O-methyltransferase]
GTGACGAAGCCGACTCCGAACGAGATTGGTAAGGGCTACGACGCTTTCGCGGACCTGCTT
GACCAGTTCTGGGGTGAAAACCTGCACCACGGATACTGGGACGACGAGTCCGCGACGCTC
GAAGAGGCCACCACGCGGCTGACCGACCGGCTGGCCGGGATGCTCCCGCTGCGCGCCGGC
GACCGGCTGCTCGACATCGGCTGCGGCAACGGCGAACCGGCGATCCGGATGGCCACCGCG
AACGACGTCATGGTCACCGGCATCTCGATCAGCGAGAAGCAGGTGGAACGGGCGAACGAC
CGCGCGTACAAGGCCGACGTGGACGACCGGGTCGTCTTCGAGTACGCCGACGCGATGGAG
CTGCCGTACCCGGACGCGTCGTTCGACGTCGTCTGGGCGCTGGAGTCCCTGCACCACATG
CCGGACCGCTGGCACGTGATCCGCCAGGCGGCCCGGGTGCTGCGGCCGGGCGGCCGCCTG
GCGCTCGGCGACTTCCTGCTCGTGCCGAGCCCGGCCGGCCTCGAGGCCGACGCCGAGCGC
GTGCGCGAGGTGGGCAAGGGCGTGGTGGCGGTCGTCTCGCTCGACGAGTACCAGGCGCAC
CTGCGCGAGGCCGGGCTGGAGCCCGAATCCGCCGAGGACGTCAGCCAGTACACCCGGCCG
TCGTGGACCAAGGCGGCGGAGCGGTTCGAAGGACTGCGGGAACAGGCCCTGCAGCACATC
GAGGCCGCGCAGTTCGAGGTCACCCTCGGCCGGTTCCGCGCGTTCAGCGAGGAACCGTCG
CTGGGGTACGTCCTGCTGACCGCGCGCAAGCCCGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013216 Methyltransferase type 11 (Domain)
 [64-161]  2.6e-25 PF08241
PF08241   Methyltransf_11
SignalP No significant hit
TMHMM No significant hit