close all open/close all

CDS information : Rifam_00570


close this sectionLocation

Organism
StrainS699
Entry nameRifamycin
Contig
Start / Stop / Direction99,201 / 99,893 / + [in whole cluster]
99,201 / 99,893 / + [in contig]
Location99201..99893 [in whole cluster]
99201..99893 [in contig]
TypeCDS
Length693 bp (230 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative transketolase(fragment)
Product (GenBank)putative transketolase A subunit
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF15A
Reference
ACC
PmId
[9512878] Biosynthesis of the ansamycin antibiotic rifamycin: deductions from the molecular analysis of the rif biosynthetic gene cluster of Amycolatopsis mediterranei S699. (Chem Biol. , 1998)
Related Reference
ACC
D8HZB6
PmId
[20567260] Complete genome sequence of the rifamycin SV-producing Amycolatopsis mediterranei U32 revealed its genetic characteristics in phylogeny and metabolism. (Cell Res. , 2010)
[21986914] Two genes, rif15 and rif16, of the rifamycin biosynthetic gene cluster in Amycolatopsis mediterranei likely encode a transketolase and a P450 monooxygenase, respectively, both essential for the conversion of rifamycin SV into B. (Acta Biochim Biophys Sin (Shanghai). , 2011)
Family/Domain
FD
IPR005474

close this sectionSequence

selected fasta
>putative transketolase(fragment) [putative transketolase A subunit]
MQMTEENLRGLFGRMTGDEKHGWAAASTLHAIWVLYERVLNVSPSNIDDPGRDRFYLSKG
HGPMAYYAVLAAKGFIEPETLDTWRQWGSPLGMHPDRNLAPGVEISSGSLGHGLPLGVGT
ALGLRAQGRDARVVVLMGDGEFDEGSNHETMAIAGRLGLGSLTAVVIDNKTASLGWPGGI
AGRFEQEGWAATTVDGRDHDALEKALTGETDGRPRAVIAEILPIEEGSTA
selected fasta
>putative transketolase(fragment) [putative transketolase A subunit]
ATGCAGATGACCGAAGAGAACCTCCGCGGCCTGTTCGGCCGGATGACGGGGGACGAGAAG
CACGGCTGGGCCGCGGCGTCGACATTGCACGCGATCTGGGTGCTCTACGAACGCGTGCTC
AACGTGTCGCCGTCGAACATCGACGACCCCGGCCGGGACCGGTTCTACCTCTCCAAGGGA
CACGGCCCGATGGCCTACTACGCGGTGCTCGCCGCGAAGGGCTTCATCGAGCCGGAAACG
CTGGACACCTGGCGGCAGTGGGGTTCGCCGCTGGGCATGCACCCGGACCGCAACCTGGCG
CCCGGCGTGGAGATCAGCAGCGGCTCCCTCGGCCACGGGCTCCCGCTCGGCGTCGGCACC
GCGCTCGGGCTGCGCGCCCAGGGCCGCGACGCCCGCGTGGTCGTCCTGATGGGCGACGGC
GAGTTCGACGAGGGCAGCAACCACGAGACGATGGCGATCGCCGGACGGCTCGGGCTGGGC
AGCCTCACCGCGGTCGTCATCGACAACAAGACGGCGAGCCTCGGCTGGCCGGGCGGCATC
GCCGGGCGCTTCGAACAGGAGGGCTGGGCCGCCACCACGGTCGACGGCCGCGACCACGAC
GCGCTGGAGAAGGCGCTGACCGGGGAGACCGACGGGCGGCCGCGCGCGGTCATCGCGGAG
ATCCTCCCGATCGAGGAAGGGAGCACCGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005474 Transketolase, N-terminal (Domain)
 [22-216]  1.3e-32 PF00456
PF00456   Transketolase_N
SignalP No significant hit
TMHMM No significant hit