close all open/close all

CDS information : Rifam_00580


close this sectionLocation

Organism
StrainS699
Entry nameRifamycin
Contig
Start / Stop / Direction99,890 / 100,801 / + [in whole cluster]
99,890 / 100,801 / + [in contig]
Location99890..100801 [in whole cluster]
99890..100801 [in contig]
TypeCDS
Length912 bp (303 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative transketolase(fragment)
Product (GenBank)putative transketolase B subunit
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF15B
Reference
ACC
PmId
[9512878] Biosynthesis of the ansamycin antibiotic rifamycin: deductions from the molecular analysis of the rif biosynthetic gene cluster of Amycolatopsis mediterranei S699. (Chem Biol. , 1998)
Related Reference
ACC
D8HZB7
PmId
[20567260] Complete genome sequence of the rifamycin SV-producing Amycolatopsis mediterranei U32 revealed its genetic characteristics in phylogeny and metabolism. (Cell Res. , 2010)
[21986914] Two genes, rif15 and rif16, of the rifamycin biosynthetic gene cluster in Amycolatopsis mediterranei likely encode a transketolase and a P450 monooxygenase, respectively, both essential for the conversion of rifamycin SV into B. (Acta Biochim Biophys Sin (Shanghai). , 2011)
Family/Domain
FD
IPR005475

close this sectionSequence

selected fasta
>putative transketolase(fragment) [putative transketolase B subunit]
MTAQVTRKQMRTVFAETVIESLATDPRVVMLTADISSWFFWEVKKDFPDRVHNFGIREQA
MIDIAGGFALAGQRPVVHTYAPFLVERPFEQIKIGLGHQDVGAVLVSVGASYDDPSWGRT
HQAPGDVALLDTLPGWTVHVPGHEDEVAPLLSKAIAGDNRVYVRLSERANSEAVPVSEKF
TVLRRGKAGVVLAVGPVLDQVLAATATADVTVLYASTIRPFDHAGLREAVAAAAPNVVLV
DPYLRGTSAFEVTEALGDVPHRLRSFGTWRDREARVYGTPEEHDRLFGVDAESLADSIAR
FVG
selected fasta
>putative transketolase(fragment) [putative transketolase B subunit]
ATGACCGCCCAGGTGACCAGGAAGCAGATGCGGACCGTCTTCGCCGAGACGGTGATCGAG
TCGCTGGCCACGGACCCGCGCGTGGTCATGCTGACCGCCGACATCTCGTCGTGGTTCTTC
TGGGAGGTCAAGAAGGACTTCCCGGACCGCGTCCACAACTTCGGCATCCGCGAGCAGGCG
ATGATCGACATCGCCGGCGGCTTCGCGCTGGCCGGCCAGCGGCCGGTGGTGCACACGTAC
GCGCCGTTCCTGGTCGAGCGGCCGTTCGAGCAGATCAAGATCGGCCTCGGCCACCAGGAC
GTCGGCGCGGTGCTGGTCAGCGTGGGCGCCTCCTACGACGACCCGTCGTGGGGCCGCACC
CACCAGGCCCCGGGCGACGTGGCGCTGCTGGACACGCTGCCGGGCTGGACGGTGCACGTC
CCGGGCCACGAGGACGAGGTCGCGCCCCTGCTGAGCAAGGCCATCGCGGGTGACAACCGG
GTCTACGTCCGGCTGTCCGAACGCGCGAACAGCGAAGCGGTGCCGGTGTCGGAGAAGTTC
ACGGTGCTGCGCCGGGGCAAGGCGGGCGTGGTGCTCGCGGTCGGCCCGGTGCTGGACCAG
GTCCTGGCGGCCACGGCCACGGCGGACGTGACGGTGCTGTACGCCTCGACGATCCGCCCG
TTCGACCACGCGGGCCTCCGGGAGGCGGTGGCCGCGGCGGCCCCGAACGTGGTGCTGGTC
GACCCGTACCTGCGCGGGACGTCGGCGTTCGAGGTGACCGAGGCTCTGGGAGACGTCCCG
CACCGCCTGCGCTCGTTCGGAACCTGGCGCGACCGCGAAGCCCGCGTCTACGGAACGCCC
GAGGAACACGACCGCCTGTTCGGCGTGGACGCCGAGTCGCTGGCGGATTCGATCGCCCGC
TTCGTCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005475 Transketolase-like, pyrimidine-binding domain (Domain)
 [8-169]  6.00000000000001e-28 PF02779
PF02779   Transket_pyr
 [8-173]  7.60000011115812e-25 SM00861
SM00861   Transket_pyr
IPR009014 Transketolase, C-terminal/Pyruvate-ferredoxin oxidoreductase, domain II (Domain)
 [172-303]  5.90000104995095e-13 SSF52922
SSF52922   Transketo_C_like
IPR015941 Transketolase-like, C-terminal (Domain)
 [180-299]  3.3e-07 G3DSA:3.40.50.920
G3DSA:3.40.50.920   Transketo_C_like
SignalP
 [1-15]  0.207 Signal
Bacteria, Gram-negative   
TMHMM No significant hit