close all open/close all

CDS information : Rifam_00590


close this sectionLocation

Organism
StrainS699
Entry nameRifamycin
Contig
Start / Stop / Direction102,231 / 101,062 / - [in whole cluster]
102,231 / 101,062 / - [in contig]
Locationcomplement(101062..102231) [in whole cluster]
complement(101062..102231) [in contig]
TypeCDS
Length1,170 bp (389 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative cytochrome P450
Product (GenBank)putative cytochrome P450 monooxygenase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF16
Reference
ACC
PmId
[9512878] Biosynthesis of the ansamycin antibiotic rifamycin: deductions from the molecular analysis of the rif biosynthetic gene cluster of Amycolatopsis mediterranei S699. (Chem Biol. , 1998)
[16079331] Identification of tailoring genes involved in the modification of the polyketide backbone of rifamycin B by Amycolatopsis mediterranei S699. (Microbiology. , 2005)
Related Reference
ACC
A6YRR3
PmId
[19376895] Characterization of P450 FcpC, the enzyme responsible for bioconversion of diosgenone to isonuatigenone in Streptomyces virginiae IBL-14. (Appl Environ Microbiol. , 2009)
ACC
D8HZB8
PmId
[20567260] Complete genome sequence of the rifamycin SV-producing Amycolatopsis mediterranei U32 revealed its genetic characteristics in phylogeny and metabolism. (Cell Res. , 2010)

close this sectionSequence

selected fasta
>putative cytochrome P450 [putative cytochrome P450 monooxygenase]
MPPALVAVSERGPVARATLAAGDPFWLVSGYEEARAVLSDPRFSSDRFQYHPRFKELSPE
FRERLRDDKARAGSFINMDPPEHTRYRKLLTGQFTVRRIRELGARIDEIVAGRVDAMLAG
GTTADLMTEFAFPAPSLMICELLGVRYEDRAEFQQRASALLQMNAPVAEAVKNADALRAF
MQALVTDKRANPAGDIISGLIHHAGADPALTDDELINIANLLLIAGYDTTASMLGLGIFV
LLQRPAQLATLRDDPSRIADAVEGLLRYLSVVNPGIFRFAKEDLEFAGEHIPAGSTVVVS
VVATNRDARHWPDPDLDLTRPRGPHLAFGHGVHQCLGQQLARMEMQAGYAELLRRLPNVR
LAVPPEEVPLRNDMLTYGVHSLPIAWDAP
selected fasta
>putative cytochrome P450 [putative cytochrome P450 monooxygenase]
GTGCCGCCCGCTTTGGTGGCCGTCTCCGAACGGGGTCCCGTCGCCCGGGCGACACTGGCC
GCCGGCGACCCGTTCTGGCTCGTGTCCGGGTACGAGGAAGCGCGCGCGGTGCTGTCGGAC
CCGCGCTTTTCCTCCGACCGGTTCCAGTACCACCCGCGGTTCAAGGAACTGTCGCCCGAA
TTCCGGGAGCGCCTGCGGGACGACAAAGCGCGCGCGGGGTCGTTCATCAACATGGACCCG
CCGGAGCACACCCGGTACCGGAAACTGCTCACCGGGCAGTTCACCGTCCGGCGGATCCGC
GAGCTCGGCGCCCGGATCGACGAGATCGTCGCCGGCCGGGTGGACGCCATGCTGGCCGGC
GGGACCACCGCCGACCTGATGACCGAATTCGCGTTTCCGGCGCCTTCGCTGATGATCTGC
GAGCTGCTCGGGGTGCGGTACGAGGACCGGGCGGAGTTCCAGCAGCGCGCGTCGGCCCTG
CTGCAGATGAACGCCCCGGTCGCGGAGGCGGTGAAGAACGCCGACGCCCTGCGCGCGTTC
ATGCAGGCGCTGGTCACGGACAAGCGGGCGAACCCGGCGGGCGACATCATCTCCGGCCTG
ATCCACCACGCCGGCGCCGACCCCGCGCTCACCGACGACGAGCTGATCAACATCGCCAAC
CTGCTGCTCATCGCCGGCTACGACACCACGGCGAGCATGCTGGGGCTGGGCATCTTCGTG
CTGCTGCAGCGCCCCGCCCAGCTCGCCACGCTGCGCGACGACCCGTCCCGCATCGCCGAC
GCGGTCGAAGGACTGCTGCGCTACCTGTCCGTGGTGAACCCGGGGATCTTCCGCTTCGCC
AAGGAGGACCTGGAGTTCGCCGGCGAGCACATCCCGGCCGGTTCGACGGTGGTGGTCTCC
GTGGTGGCGACCAACCGCGACGCGCGGCACTGGCCGGACCCGGACCTCGACCTGACCCGC
CCCCGCGGCCCCCACCTGGCGTTCGGCCACGGCGTGCACCAGTGCCTCGGCCAGCAGCTG
GCCCGGATGGAGATGCAGGCGGGCTACGCCGAGCTGCTGCGCCGCCTGCCGAACGTTCGC
CTGGCGGTGCCGCCGGAGGAGGTTCCGCTGCGCAACGACATGCTGACTTACGGGGTGCAC
TCGCTTCCGATCGCCTGGGACGCTCCCTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [225-242]  3.79999862644791e-07 PR00385 [326-335]  3.79999862644791e-07 PR00385 [335-346]  3.79999862644791e-07 PR00385
PR00385   P450
 [27-253]  2.1e-05 PF00067 [265-356]  3.7e-18 PF00067
PF00067   p450
 [7-387]  2.70000000000002e-105 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [1-386]  1.19999063421924e-92 SSF48264
SSF48264   Cytochrome_P450
IPR002397 Cytochrome P450, B-class (Family)
 [78-89]  6.70002630158883e-47 PR00359 [125-141]  6.70002630158883e-47 PR00359 [142-157]  6.70002630158883e-47 PR00359 [179-201]  6.70002630158883e-47 PR00359 [260-271]  6.70002630158883e-47 PR00359 [278-305]  6.70002630158883e-47 PR00359 [326-335]  6.70002630158883e-47 PR00359 [335-346]  6.70002630158883e-47 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [328-337]  PS00086
PS00086   CYTOCHROME_P450
SignalP No significant hit
TMHMM No significant hit