close all open/close all

CDS information : Rifam_00610


close this sectionLocation

Organism
StrainS699
Entry nameRifamycin
Contig
Start / Stop / Direction103,594 / 104,808 / + [in whole cluster]
103,594 / 104,808 / + [in contig]
Location103594..104808 [in whole cluster]
103594..104808 [in contig]
TypeCDS
Length1,215 bp (404 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative LuxR family transcriptional regulator
Product (GenBank)putative regulatory protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF36
Reference
ACC
PmId
[16079331] Identification of tailoring genes involved in the modification of the polyketide backbone of rifamycin B by Amycolatopsis mediterranei S699. (Microbiology. , 2005)
Family/Domain
FD
IPR000792

close this sectionSequence

selected fasta
>putative LuxR family transcriptional regulator [putative regulatory protein]
MQRSCDTAGFLRRSASSWFNGRLDTGLHCARAAATGNRRESDELSQLARFWYVGLLIKAR
DLDAGRRVLESAEADRGGAASDRMTAVEHNVRGSLLFAMGSVDDAMAEISTGLRIAERCG
DRSLRPPSYVVLALGALRRADMRACRHFVDKLSDEALLGYFGQAPGAWVAAQAVEARSGV
ESAASLIAGIVTNPVVLRQLLVSEPAAASWLVRACVKLGAHDLAKASAAESAALAAEQPE
FSVIRGSALHAAGLLEQDAAKLHEAADIHPDRWCAASAREDLASLLTVRCSERDRTIRIL
ESVLDTYTSVSATRDSARVVNKLREYGVRRGTTRTVECEGTVPHGLTNTEFAVAELVSQG
HTNNEVGRQLFISRHTVAFHLKKVFQKMNLTSRVELAAAWKVFS
selected fasta
>putative LuxR family transcriptional regulator [putative regulatory protein]
ATGCAGCGGTCCTGTGACACCGCTGGTTTCCTCCGCCGCTCGGCCTCGTCGTGGTTCAAC
GGGCGGCTCGACACGGGGTTGCACTGTGCCAGGGCAGCGGCCACGGGCAACCGCCGGGAA
TCCGACGAACTCAGCCAGCTGGCTCGGTTCTGGTACGTCGGGTTGCTGATCAAGGCCCGG
GACCTCGACGCGGGCCGCCGGGTGCTCGAGTCGGCGGAGGCGGATCGGGGCGGGGCAGCC
TCCGACCGCATGACCGCCGTCGAGCACAACGTGCGGGGCAGCCTGCTGTTCGCCATGGGC
AGCGTCGACGACGCGATGGCGGAAATCAGCACCGGGCTGCGGATCGCCGAGCGCTGTGGT
GACCGGTCGCTGCGGCCGCCCAGTTACGTCGTGCTGGCGCTGGGTGCCCTTCGCCGCGCG
GACATGCGGGCGTGCCGCCACTTCGTCGACAAGCTGTCGGACGAAGCGCTGCTCGGTTAC
TTCGGGCAGGCGCCGGGAGCGTGGGTGGCCGCGCAGGCCGTGGAAGCCCGCAGCGGCGTG
GAGAGCGCGGCGAGCCTGATCGCCGGGATCGTGACGAACCCGGTGGTGCTCCGGCAGCTG
CTGGTGTCGGAACCGGCGGCGGCGTCCTGGCTGGTCCGCGCGTGCGTCAAGCTCGGCGCG
CACGACCTGGCGAAGGCTTCGGCGGCGGAGTCCGCCGCGCTGGCCGCCGAGCAGCCGGAG
TTCAGCGTGATCCGCGGCTCCGCCCTGCACGCGGCGGGCCTGCTGGAGCAGGACGCGGCC
AAGCTCCACGAGGCGGCCGACATCCACCCCGACCGCTGGTGCGCGGCCTCGGCGCGCGAG
GACCTGGCGAGCCTGCTGACCGTCCGGTGTTCCGAACGCGACCGGACGATCAGGATCCTC
GAGTCGGTCCTGGACACGTACACGTCGGTGAGCGCCACCCGCGACTCGGCCCGGGTGGTG
AACAAGCTCCGCGAGTACGGCGTCCGCCGCGGCACGACCCGGACGGTCGAGTGCGAAGGC
ACCGTCCCGCACGGGCTGACGAACACGGAGTTCGCGGTGGCGGAGCTGGTGAGCCAGGGC
CACACCAACAACGAGGTGGGCCGGCAGCTGTTCATCTCCCGGCACACGGTGGCGTTCCAC
CTGAAGAAGGTGTTCCAGAAGATGAACCTCACCTCCAGGGTCGAGCTGGCGGCGGCGTGG
AAGGTGTTCTCGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000792 Transcription regulator LuxR, C-terminal (Domain)
 [339-404]  19.679 PS50043
PS50043   HTH_LUXR_2
 [346-360]  2.7e-08 PR00038 [360-376]  2.7e-08 PR00038 [376-388]  2.7e-08 PR00038
PR00038   HTHLUXR
 [343-400]  2.6e-16 SM00421
SM00421   helix_turn_helix, Lux Regulon
 [345-398]  2.9e-15 PF00196
PF00196   GerE
IPR011990 Tetratricopeptide-like helical (Domain)
 [83-283]  8.9e-14 G3DSA:1.25.40.10
G3DSA:1.25.40.10   no description
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [341-399]  4.6e-16 G3DSA:1.10.10.10
G3DSA:1.10.10.10   no description
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [324-400]  2e-14 SSF46894
SSF46894   C-terminal effector domain of the bipartite response regulators
SignalP No significant hit
TMHMM No significant hit