close all open/close all

CDS information : Rifam_00630


close this sectionLocation

Organism
StrainS699
Entry nameRifamycin
Contig
Start / Stop / Direction105,773 / 109,276 / + [in whole cluster]
105,773 / 109,276 / + [in contig]
Location105773..109276 [in whole cluster]
105773..109276 [in contig]
TypeCDS
Length3,504 bp (1,167 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.4 resistance
Productputative rifamycin-resistant DNA-directed RNA polymerase subunit beta
Product (GenBank)RpoB
Gene
Gene (GenBank)rpoB
EC number2.7.7.6
Keyword
Note
Note (GenBank)
  • DNA-dependent RNA polymerase beta-subunit
Reference
ACC
PmId
[9512878] Biosynthesis of the ansamycin antibiotic rifamycin: deductions from the molecular analysis of the rif biosynthetic gene cluster of Amycolatopsis mediterranei S699. (Chem Biol. , 1998)
[16079331] Identification of tailoring genes involved in the modification of the polyketide backbone of rifamycin B by Amycolatopsis mediterranei S699. (Microbiology. , 2005)
Related Reference
ACC
P0A680
PmId
[8031050] The rpoB gene of Mycobacterium tuberculosis. (Antimicrob Agents Chemother. , 1994)
[21704562] Rifamycin inhibition of WT and Rif-resistant Mycobacterium tuberculosis and Escherichia coli RNA polymerases in vitro. (Tuberculosis (Edinb). , 2011)
Family/Domain
FD
IPR010243

close this sectionSequence

selected fasta
>putative rifamycin-resistant DNA-directed RNA polymerase subunit beta [RpoB]
MAVSPANQATAATTSAESRSEATGIPGAPKRVSFAKIREPLNTPNLLDVQIQSFQWFTGD
EAWFQRRVEEGEENPVGGLEEVLNEISPIEDFSGSMSLSFSAPRFDEVKASIEECKDKDM
TYAAPLFVTAEFVNNNTGEIKSQTVFLGDFPVMTDKGTFVINGTERVVVSQLVRSPGVYY
SKDIDKTSDKDVFSVRVIPSRGAWLEFDVDKRDTVGVRIDRKRRQPVTVLLKALGWTTEA
IRERFSFSETLLATLEKDHTAGTDEALLDIYRKLRPGEPPTKESAQTLLENLFFKAKRYD
LAKVGRYKVNKKLGLSTPIENGTLTEEDIVTIIEYLVRLHAGEDKMTAANNTEIPVETDD
IDHFGNRRIRTVGELIQNQIRVGLSRTERVVRERMTTQDVEAITPQTLINIRPIGAAIKE
FFGTSQLSQFMQQTNPIDGLTHKRRLNALGPGGLSRERAGMEVRDVHPSHYGRMCPIETP
EGPNIGLIGSLCSYARVNPFGFIETPYRKVVEGRVTDQIDYLTADEEDRFVKAQANAPIS
DDGTFIEDRVMARRKGGEVELIDPLDIDYMDVSPRQMVSIATAMIPFLEHDDANRALMGA
NMQRQAVPLLRSQAPYVGTGVELRAAIDSGDMLVAEQSGVVEELSADLITVMHDDGTRKS
YSLYKFRRSNHGTCFNHRPIVNEGDRIEAGQVIADGPSTENGEVALGKNLLVAVMPWEGH
NYEDAIILSERLVQDDVLTSIHIEEHEIDARDTKLGAEEITRDIPNVSEEVLADLDERGI
IRIGAEVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGETGKVIG
IRVFSREDDDELPPGVNELVRVYVAQKRKIQPGDKLAGRHGNKGVIGKILPVEDMPFMED
GTPVDIILNTHGVPRRMNIGQILELHLGWLASQGWTIEGDPDWAKNLSAELRDVAPGTNT
ATPVFDGAKEEELTGLLSATKPNRDGERMVKENGKANLFDGRSGEPYPYPVAVGYMYILK
LHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIK
SDDVVGRVKVYEAIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSSDGSSIEMRDSGD
EDLERAAANLGINLSRNESPSVDDVVH
selected fasta
>putative rifamycin-resistant DNA-directed RNA polymerase subunit beta [RpoB]
TTGGCAGTCTCTCCCGCGAACCAGGCCACTGCTGCGACCACCTCGGCTGAATCTCGCTCG
GAGGCCACGGGAATCCCCGGCGCGCCCAAGCGGGTTTCCTTCGCAAAGATTCGCGAACCC
CTGAACACCCCCAACCTGCTCGACGTCCAGATCCAGTCGTTCCAGTGGTTCACCGGGGAC
GAAGCGTGGTTCCAGCGCCGTGTCGAGGAAGGTGAAGAGAACCCGGTCGGCGGCCTCGAA
GAGGTCCTCAACGAGATCTCCCCGATCGAAGACTTCTCCGGTTCGATGTCCCTGTCCTTC
TCCGCCCCGCGCTTCGACGAGGTCAAGGCCTCGATCGAGGAGTGCAAGGACAAGGACATG
ACGTACGCGGCCCCGCTGTTCGTCACGGCGGAGTTCGTCAACAACAACACGGGCGAGATC
AAGAGCCAGACGGTCTTCCTGGGCGACTTCCCGGTGATGACCGACAAGGGCACCTTCGTC
ATCAACGGCACCGAGCGTGTCGTGGTGTCCCAGCTGGTCCGCTCGCCGGGCGTCTACTAC
TCCAAGGACATCGACAAGACGAGCGACAAGGACGTCTTCAGCGTCCGCGTCATCCCGAGC
CGCGGTGCCTGGCTGGAGTTCGACGTCGACAAGCGCGACACCGTCGGCGTCCGCATCGAC
CGCAAGCGCCGCCAGCCGGTCACCGTGCTGCTGAAGGCGCTCGGCTGGACCACCGAGGCG
ATCCGCGAGCGCTTCTCCTTCTCGGAGACGCTGCTCGCCACCCTCGAGAAGGACCACACC
GCCGGCACCGACGAGGCGCTGCTCGACATCTACCGCAAGCTCCGCCCGGGCGAACCGCCC
ACCAAGGAGAGCGCGCAGACCCTGCTGGAGAACCTGTTCTTCAAGGCGAAGCGCTACGAC
CTGGCCAAGGTCGGCCGGTACAAGGTCAACAAGAAGCTGGGCCTCTCGACCCCGATCGAG
AACGGCACGCTGACCGAAGAGGACATCGTCACGATCATCGAGTACCTGGTCCGGCTGCAC
GCCGGCGAGGACAAGATGACCGCGGCGAACAACACCGAGATCCCGGTCGAGACCGACGAC
ATCGACCACTTCGGCAACCGCCGGATCCGGACCGTCGGCGAGCTGATCCAGAACCAGATC
CGGGTCGGCCTGTCGCGCACTGAGCGCGTCGTCCGCGAGCGCATGACCACGCAGGACGTC
GAGGCGATCACCCCGCAGACCCTGATCAACATCCGCCCGATCGGCGCGGCGATCAAGGAG
TTCTTCGGCACCTCGCAGCTGTCGCAGTTCATGCAGCAGACGAACCCGATCGACGGCCTG
ACCCACAAGCGCCGCCTCAACGCGCTGGGCCCGGGTGGTCTGTCGCGTGAGCGCGCCGGC
ATGGAGGTCCGCGACGTCCACCCGTCGCACTACGGCCGGATGTGCCCGATCGAGACGCCG
GAAGGCCCGAACATCGGCCTGATCGGCTCGCTCTGCTCCTACGCGCGGGTCAACCCGTTC
GGCTTCATCGAGACGCCGTACCGCAAGGTCGTCGAGGGCCGGGTCACCGACCAGATCGAC
TACCTGACCGCGGACGAAGAAGACCGGTTCGTCAAGGCCCAGGCCAACGCGCCGATCTCG
GACGACGGCACCTTCATCGAAGACCGGGTCATGGCCCGCCGCAAGGGCGGCGAGGTCGAG
CTGATCGACCCGCTCGACATCGACTACATGGACGTGTCGCCGCGGCAGATGGTCTCGATC
GCGACGGCGATGATCCCGTTCCTCGAGCACGACGACGCGAACCGCGCGCTGATGGGCGCG
AACATGCAGCGTCAGGCCGTGCCGCTGCTGCGCAGCCAGGCGCCGTACGTCGGCACCGGC
GTGGAGCTGCGGGCCGCGATCGACTCCGGCGACATGCTGGTCGCCGAGCAGTCGGGCGTG
GTGGAGGAGCTGTCGGCGGACCTGATCACGGTCATGCACGACGACGGCACGCGGAAGAGC
TACAGCCTCTACAAGTTCCGCCGCTCGAACCACGGCACCTGCTTCAACCACCGCCCGATC
GTCAACGAGGGCGACCGGATCGAAGCGGGCCAGGTCATCGCCGACGGCCCGTCCACCGAA
AACGGTGAGGTGGCGCTCGGCAAGAACCTGCTGGTCGCGGTCATGCCGTGGGAGGGCCAC
AACTACGAGGACGCGATCATCCTCTCCGAGCGCCTGGTGCAGGACGACGTGCTGACGTCG
ATCCACATCGAGGAGCACGAGATCGATGCCCGCGACACGAAGCTGGGCGCCGAGGAGATC
ACCCGGGACATCCCGAACGTCTCCGAAGAAGTCCTGGCCGACCTCGACGAGCGCGGCATC
ATCCGGATCGGTGCCGAGGTCCGCGACGGCGACATCCTGGTCGGCAAGGTCACGCCGAAG
GGCGAGACCGAGCTGACCCCGGAGGAGCGCCTGCTCCGCGCGATCTTCGGCGAGAAGGCC
CGCGAGGTCCGCGACACCTCCCTGAAGGTGCCGCACGGCGAGACCGGCAAGGTCATCGGC
ATCCGGGTGTTCTCCCGCGAGGACGACGACGAGCTGCCCCCGGGCGTCAACGAGCTGGTC
CGCGTCTACGTGGCCCAGAAGCGCAAGATCCAGCCGGGCGACAAGCTCGCCGGCCGGCAC
GGGAACAAGGGTGTCATCGGCAAGATCCTGCCGGTCGAGGACATGCCGTTCATGGAGGAC
GGCACCCCGGTCGACATCATCCTGAACACCCACGGTGTCCCGCGACGGATGAACATCGGC
CAGATCCTCGAGCTGCACCTGGGCTGGCTGGCGTCGCAGGGCTGGACGATCGAGGGCGAC
CCCGACTGGGCGAAGAACCTGTCGGCCGAGCTCCGCGACGTCGCGCCCGGCACGAACACC
GCCACCCCGGTGTTCGACGGCGCGAAGGAAGAGGAGCTCACCGGGCTGCTCAGCGCGACC
AAGCCGAACCGCGACGGTGAGCGCATGGTCAAGGAGAACGGGAAGGCCAACCTGTTCGAC
GGCCGCTCGGGCGAGCCGTACCCGTACCCGGTCGCGGTCGGCTACATGTACATCCTGAAG
CTGCACCACCTGGTCGACGACAAGATCCACGCCCGCTCCACCGGTCCGTACTCGATGATC
ACGCAGCAGCCGCTGGGTGGTAAGGCGCAGTTCGGTGGCCAGCGCTTCGGTGAGATGGAG
TGCTGGGCGATGCAGGCGTACGGCGCTGCCTACACGCTGCAGGAGCTGCTGACGATCAAG
TCGGACGACGTGGTCGGCCGCGTCAAGGTGTACGAGGCCATCGTCAAGGGGGAGAACATC
CCCGAGCCGGGCATCCCGGAGTCGTTCAAGGTGCTCCTCAAGGAGCTCCAGTCGCTGTGC
CTCAACGTCGAGGTGCTCTCCAGCGACGGCTCCTCGATCGAGATGCGCGACTCCGGCGAC
GAGGACCTCGAGCGCGCCGCGGCGAACCTCGGCATCAACCTGTCCCGCAACGAGTCGCCC
TCGGTGGACGACGTCGTGCACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007120 DNA-directed RNA polymerase, subunit 2, domain 6 (Domain)
 [580-1050]  1e-157 PF00562
PF00562   RNA_pol_Rpb2_6
 [871-1028]  2e-73 G3DSA:2.40.270.10
G3DSA:2.40.270.10   no description
IPR007121 RNA polymerase, beta subunit, conserved site (Conserved_site)
 [873-885]  PS01166
PS01166   RNA_POL_BETA
IPR007641 RNA polymerase Rpb2, domain 7 (Domain)
 [1052-1126]  5.2e-30 PF04560
PF04560   RNA_pol_Rpb2_7
IPR007642 RNA polymerase Rpb2, domain 2 (Domain)
 [174-370]  1.3e-30 PF04561
PF04561   RNA_pol_Rpb2_2
IPR007644 RNA polymerase, beta subunit, protrusion (Domain)
 [45-425]  2.8e-28 PF04563
PF04563   RNA_pol_Rpb2_1
IPR007645 RNA polymerase Rpb2, domain 3 (Domain)
 [429-498]  2e-26 PF04565
PF04565   RNA_pol_Rpb2_3
IPR010243 DNA-directed RNA polymerase, beta subunit (Family)
 [32-1128]  12.245 MF_01321
MF_01321   RNApol_bact_RpoB
 [248-847]  9.5e-305 TIGR02013
TIGR02013   rpoB: DNA-directed RNA polymerase, beta subunit
IPR014724 RNA polymerase Rpb2, OB-fold (Domain)
 [738-870]  5.3e-57 G3DSA:2.40.50.150
G3DSA:2.40.50.150   no description
IPR019462 DNA-directed RNA polymerase, beta subunit, external 1 domain (Domain)
 [508-573]  2e-24 G3DSA:2.30.150.10
G3DSA:2.30.150.10   no description
 [507-573]  1.2e-25 PF10385
PF10385   RNA_pol_Rpb2_45
SignalP No significant hit
TMHMM No significant hit