close all open/close all
Rifam_00630 Rifam_00630   last last

CDS information : Rifam_00640


close this sectionLocation

Organism
StrainS699
Entry nameRifamycin
Contig
Start / Stop / Direction109,375 / 109,528 / + [in whole cluster]
109,375 / 109,528 / + [in contig]
Location109375..109528 [in whole cluster]
109375..109528 [in contig]
TypeCDS
Length154 bp (50 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative DNA-directed RNA polymerase subunit beta'(fragment)
Product (GenBank)RpoC
Gene
Gene (GenBank)rpoC
EC number
Keyword
Note
Note (GenBank)
  • DNA-dependent RNA polymerase beta'-subunit
Reference
ACC
Related Reference
ACC
P0A674
PmId
[8031050] The rpoB gene of Mycobacterium tuberculosis. (Antimicrob Agents Chemother. , 1994)

close this sectionSequence

selected fasta
>putative DNA-directed RNA polymerase subunit beta'(fragment) [RpoC]
MLDVNFFDELRIGLATADDIRQWSYGEVKKPETINYRTLKPEKDGLFCEKI-
selected fasta
>putative DNA-directed RNA polymerase subunit beta'(fragment) [RpoC]
GTGCTGGACGTCAACTTTTTCGATGAGCTCCGCATTGGTCTCGCCACGGCCGACGACATC
CGTCAGTGGTCGTACGGCGAGGTCAAGAAGCCGGAGACCATCAACTACCGGACGCTCAAG
CCCGAGAAGGACGGCCTCTTCTGCGAGAAGATCT

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007080 RNA polymerase Rpb1, domain 1 (Domain)
 [6-51]  2e-13 PF04997
PF04997   RNA_pol_Rpb1_1
SignalP
 [1-17]  0.132 Signal
Eukaryota   
TMHMM No significant hit
Rifam_00630 Rifam_00630   last last