close all open/close all
first first   Rimoc_00020 Rimoc_00020

CDS information : Rimoc_00010


close this sectionLocation

Organism
Strain108
Entry nameRimocidin
Contig
Start / Stop / Direction2 / 1,897 / + [in whole cluster]
2 / 1,897 / + [in contig]
Location2..1897 [in whole cluster]
2..1897 [in contig]
TypeCDS
Length1,896 bp (631 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase(fragment)
Product (GenBank)RimB
Gene
Gene (GenBank)rimB
EC number
Keyword
Note
Note (GenBank)
  • type I polyketide synthase
Reference
ACC
PmId
[15123265] Starter unit choice determines the production of two tetraene macrolides, rimocidin and CE-108, in Streptomyces diastaticus var. 108. (Chem Biol. , 2004)

close this sectionPKS/NRPS Module

?
KR191..367
ACP470..540

close this sectionSequence

selected fasta
>polyketide synthase(fragment) [RimB]
MTTGQLRTGDRDALFKVDWTGVALTGERADSLALLGKDTEGILDGLALQPRTDLDDLAEA
GDHDTVLVPPMAGGAGTVESVHAVAAEALGVIQAWLADERFAASRLVFVTRGAVSGEDLA
GAAVWGLVRSAQSEHPGRFGLVDVEDDADAALIPQVLASDEPQLLIRGGEVLAARLARTE
AQQPLGWDTSGTVLITGGTGGLGRIVARHLVAEHGVRSLLLVSRRGPAAEGAEELVAELR
DHGAEAVGEACDVTDAAAVADLVTRHKPTAVVHTAGVLDDGVVESLTPERLASVLRPKVD
AAWNLHEATKDLVLDAFVVFSSVAGTFGSAGQANYAAGNAFLDALAHHRRTQGLPATSLA
WGPWSQDSGMTGTLTDADVQRMARSGMPPLSAEEGVALFDAALASGEPATVPARLDLAAL
RRQGEVVPLLRGLIRTSGRRTAAAATDGDAAAAFAQRLTGLSAAEGREVVLDAVRGQVAA
VLGHGGATEIDEDRAFLDLGFDSLTAVELRNRLSALTGIRLPATLLFDYPTPAELVDHLQ
ARIAPEPSFGPEALLGELERLEKGFGELVITEEVHEQIAGRLEVLRAKWQALRDTAPAAG
RDGSPADEDFDFESASDEEVFDLLDNELGLN
selected fasta
>polyketide synthase(fragment) [RimB]
ATCACCACCGGGCAGCTCCGGACCGGCGACCGTGACGCCCTCTTCAAGGTCGACTGGACC
GGCGTAGCCCTCACGGGCGAGCGCGCGGACTCCCTCGCCCTGCTCGGCAAGGACACCGAA
GGCATCCTCGACGGCCTCGCGCTCCAGCCCCGCACGGATCTCGACGACCTCGCGGAGGCA
GGCGACCACGACACCGTGCTCGTCCCGCCGATGGCCGGGGGTGCCGGGACGGTGGAGTCC
GTTCACGCCGTGGCGGCCGAGGCGCTGGGTGTGATCCAGGCGTGGCTGGCGGATGAGCGG
TTCGCGGCTTCGCGTCTGGTGTTCGTGACGCGGGGCGCGGTGTCGGGTGAGGATCTCGCA
GGTGCGGCGGTGTGGGGCCTGGTGCGGTCGGCGCAGTCGGAGCACCCGGGCCGCTTCGGC
CTGGTGGACGTGGAAGACGACGCCGATGCAGCGCTGATACCGCAGGTATTGGCATCCGAC
GAGCCGCAACTGCTGATACGCGGCGGCGAGGTGCTGGCGGCGCGCCTGGCCCGTACGGAG
GCCCAGCAGCCCCTGGGCTGGGACACCTCCGGCACGGTGTTGATCACCGGTGGTACGGGG
GGTCTCGGCCGCATCGTCGCCCGGCACCTGGTGGCGGAGCACGGGGTACGGAGTCTGCTG
CTGGTCAGCCGCAGGGGTCCGGCTGCCGAGGGCGCCGAGGAGTTGGTGGCCGAGCTGCGG
GACCACGGCGCCGAGGCGGTGGGCGAGGCATGCGACGTAACCGACGCGGCGGCCGTCGCC
GACCTCGTTACGCGTCACAAGCCGACCGCTGTGGTGCATACGGCCGGTGTCCTGGACGAC
GGCGTGGTGGAGTCGCTGACCCCCGAGCGGCTCGCGTCCGTACTGCGCCCGAAGGTCGAT
GCGGCCTGGAACCTGCACGAGGCGACCAAGGATCTGGTTCTGGACGCGTTCGTGGTGTTC
TCCTCCGTGGCCGGCACTTTCGGCAGCGCGGGTCAGGCCAACTACGCGGCCGGTAACGCC
TTCTTGGACGCTCTCGCTCACCACCGCCGGACGCAGGGCCTTCCGGCCACGTCGCTCGCG
TGGGGCCCGTGGTCCCAGGACAGCGGCATGACCGGCACCCTCACCGACGCCGACGTCCAG
CGCATGGCCCGCTCGGGCATGCCGCCGCTGTCGGCCGAGGAAGGCGTGGCGCTGTTCGAC
GCGGCCCTCGCCAGTGGGGAGCCCGCGACCGTGCCCGCTCGCCTCGACCTGGCGGCCCTG
CGCCGGCAGGGCGAGGTGGTCCCGCTGCTGCGCGGCCTGATCAGGACCTCGGGCCGGCGT
ACGGCGGCGGCCGCGACCGACGGCGACGCCGCGGCCGCCTTCGCCCAGCGGCTGACCGGC
CTGTCGGCGGCGGAAGGACGCGAGGTCGTCCTCGATGCCGTACGCGGCCAGGTCGCGGCC
GTTCTGGGACACGGCGGGGCCACGGAGATCGATGAGGACCGTGCCTTCCTGGACCTCGGT
TTCGACTCCCTCACCGCGGTCGAACTCCGCAACCGGCTGAGTGCCCTCACGGGAATCCGC
CTGCCGGCGACGCTGCTGTTCGACTACCCGACGCCGGCGGAACTCGTCGACCACCTCCAG
GCCCGCATCGCACCCGAGCCGTCCTTCGGCCCGGAAGCGCTCCTGGGCGAACTCGAAAGG
CTGGAGAAGGGCTTCGGTGAACTCGTCATCACCGAGGAGGTGCACGAGCAGATAGCCGGC
CGCCTGGAAGTCCTCCGGGCGAAGTGGCAGGCCCTGCGGGACACGGCCCCGGCGGCCGGG
CGCGACGGCTCCCCGGCCGACGAGGACTTCGACTTCGAGTCCGCCTCCGACGAGGAGGTC
TTCGACCTCCTCGACAACGAACTCGGCCTGAACTGA
[?] KR191..367
[?] ACP470..540
[?] KR571..1101
[?] ACP1408..1620

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006162 Phosphopantetheine attachment site (PTM)
 [498-513]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [470-540]  22.488 PS50075
PS50075   ACP_DOMAIN
 [468-544]  7.5e-24 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   no description
 [473-539]  3.2e-15 PF00550
PF00550   PP-binding
 [461-547]  2.2e-25 SSF47336
SSF47336   ACP-like
IPR013968 Polyketide synthase, KR (Domain)
 [191-366]  8.2e-65 PF08659
PF08659   KR
IPR016040 NAD(P)-binding domain (Domain)
 [191-403]  2.7e-39 G3DSA:3.40.50.720
G3DSA:3.40.50.720   no description
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [471-543]  8.7e-33 SM00823
SM00823   Phosphopantetheine attachment site
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [191-367]  2.7e-62 SM00822
SM00822   no description
SignalP No significant hit
TMHMM No significant hit
first first   Rimoc_00020 Rimoc_00020