close all open/close all

CDS information : Rimoc_00020


close this sectionLocation

Organism
Strain108
Entry nameRimocidin
Contig
Start / Stop / Direction3,133 / 2,006 / - [in whole cluster]
3,133 / 2,006 / - [in contig]
Locationcomplement(2006..3133) [in whole cluster]
complement(2006..3133) [in contig]
TypeCDS
Length1,128 bp (375 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)RimC
Gene
Gene (GenBank)rimC
EC number
Keyword
Note
Note (GenBank)
  • tyrosine phosphatase
Reference
ACC
PmId
[15123265] Starter unit choice determines the production of two tetraene macrolides, rimocidin and CE-108, in Streptomyces diastaticus var. 108. (Chem Biol. , 2004)

close this sectionSequence

selected fasta
>hypothetical protein [RimC]
MNSPSTAAVQTARRIAVSFVATVSAVGVTASFASAEPVAAPHTEAGRHAAQAPRATRGIP
FTQATVARQQDGSFTVSWKAPGAGSVTVYADGKVVAYGGAEATITVRRLPAADRQWFRLV
PDEGDPLTLADRSLHLEGAANFRDVGGYRTADGRWVKMGVLYRSPTPCTSSPTPTWIKLR
RLGIRTDFDLRTPGERAKAPDRVPAGARYVVANVIGEENSAELPPTAEASERLMAESYRQ
FVVRPSAAKAYRSLFRMAAEPGSYPLLYHCSSGKDRTGWATAVLLTALGVDRETVMRDYL
ASNDYLAASNAAELAKQPPEIAARLKPVLETRAPYLNAAFDEVEARFGTFGAYLREGLGL
NAQELERLRAALLTD
selected fasta
>hypothetical protein [RimC]
ATGAACTCACCATCCACGGCGGCCGTGCAGACCGCCCGCCGCATCGCCGTGTCGTTCGTC
GCCACCGTTTCGGCCGTGGGGGTCACCGCGTCCTTCGCCTCGGCCGAGCCCGTCGCCGCG
CCGCACACCGAAGCGGGACGGCACGCGGCGCAGGCGCCGCGTGCCACGCGCGGGATTCCG
TTCACCCAGGCCACGGTGGCCCGACAGCAGGACGGTTCCTTCACCGTGTCCTGGAAAGCG
CCCGGCGCCGGTTCCGTGACCGTCTACGCCGACGGCAAGGTCGTGGCATACGGCGGGGCC
GAGGCCACCATCACCGTACGCCGGCTGCCCGCGGCCGACCGTCAGTGGTTCCGCCTCGTG
CCGGACGAGGGCGACCCGCTCACCCTCGCCGACCGCTCGCTGCACCTGGAGGGCGCCGCC
AACTTCCGTGACGTGGGCGGCTACCGAACCGCCGACGGCCGGTGGGTGAAGATGGGCGTG
CTGTACCGCTCGCCGACGCCCTGCACAAGCTCACCGACGCCGACCTGGATCAAGCTGCGG
CGCCTGGGCATCCGTACGGACTTCGACCTGCGCACGCCGGGCGAGCGGGCCAAGGCCCCG
GACCGGGTACCGGCGGGCGCACGCTATGTCGTCGCCAATGTCATCGGCGAGGAGAACTCC
GCCGAACTGCCCCCCACGGCGGAGGCGTCCGAGCGGCTGATGGCCGAATCCTACCGGCAG
TTCGTCGTCAGGCCCTCGGCCGCCAAGGCTTACCGTTCGCTGTTCCGCATGGCCGCCGAG
CCCGGCTCGTACCCGCTGCTCTATCACTGCTCCAGCGGCAAGGACCGCACGGGCTGGGCG
ACGGCCGTCCTCCTCACGGCCCTCGGCGTGGACCGCGAGACGGTCATGCGCGACTACCTG
GCCAGCAACGACTATCTCGCCGCAAGCAACGCCGCCGAACTGGCCAAGCAGCCGCCCGAG
ATCGCCGCCCGCCTCAAGCCGGTCCTGGAGACCAGGGCCCCGTACCTGAACGCCGCCTTC
GACGAGGTCGAGGCGCGCTTCGGCACCTTCGGCGCCTATCTGCGGGAGGGGCTGGGGCTG
AACGCGCAGGAGCTGGAGCGGCTGCGGGCGGCGCTGCTCACCGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR025163 Tyrosine-protein phosphatase family, C-terminal domain (Domain)
 [312-373]  6.90000000000001e-17 PF13348
PF13348   Y_phosphatase3C
SignalP
 [1-35]  0.997 Signal
Bacteria, Gram-negative   
 [1-35]  1 Signal
Bacteria, Gram-positive   
 [1-35]  0.979 Signal
Eukaryota   
TMHMM No significant hit