close all open/close all

CDS information : Rimoc_00030


close this sectionLocation

Organism
Strain108
Entry nameRimocidin
Contig
Start / Stop / Direction3,375 / 5,024 / + [in whole cluster]
3,375 / 5,024 / + [in contig]
Location3375..5024 [in whole cluster]
3375..5024 [in contig]
TypeCDS
Length1,650 bp (549 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.2 function unknown
Productputative cholesterol oxidase
Product (GenBank)RimD
Gene
Gene (GenBank)rimD
EC number1.1.3.6
Keyword
Note
Note (GenBank)
  • cholesterol oxidase
Reference
ACC
PmId
[15123265] Starter unit choice determines the production of two tetraene macrolides, rimocidin and CE-108, in Streptomyces diastaticus var. 108. (Chem Biol. , 2004)
Related Reference
ACC
Q9EW96
NITE
Pimar_00120
PmId
[17379143] Cholesterol oxidases act as signaling proteins for the biosynthesis of the polyene macrolide pimaricin. (Chem Biol. , 2007)

close this sectionSequence

selected fasta
>putative cholesterol oxidase [RimD]
MIENQHLSRRRLLGLAALGGAAVAGMTTISVAPRAAAAGQGSPRAGDGAFVPAVVIGTGY
GAAVSALRLGEAGIPTLMLEMGQLWNKPADDGNIFCGMLKPDRRSSWFKSRTEAPLGSFL
WLDVINRNIDPYAGVLDKVHFDEMSVYVGRGVGGGSLVNGGMAVVPKRSYFEEVLPRVDA
AQMYDRYFPRANSMLKVNHIDKGWFEDTEWYKYARVSREQAGKAGLSTTFVPNVYDFDHM
RREADGTAPKSALAGEVIYGNNHGKQSLDKTYLAAALGTGKVTIETLHQVKAIRRQPDGS
YVLSVVQSDADGKTIAQKEIGCRHLFLGAGSLGSTELLVRARDTGTLPELNAEVGAGWGP
NGNIMTGRANHVWNPTGAHQSSIPALGIDDWDNPAAPVFAEIAPMPAGLETWVSLYLAIT
KNPERGTFVYDKATDRAKLRWTRDQNTPAVNAAKSLFDRINKANTTMYRYDLFGSQLKNF
SDDFSYHPLGGCVLGKATDLYGRVAGYQNLYVMDGALVPGSIGVNPFVTITALAERNIER
IIAEDVKAA
selected fasta
>putative cholesterol oxidase [RimD]
GTGATCGAGAACCAGCACCTGTCACGGCGCCGTCTGCTCGGACTGGCCGCCCTCGGCGGC
GCCGCCGTCGCCGGAATGACCACGATTTCCGTCGCCCCGCGCGCCGCGGCCGCCGGGCAG
GGAAGCCCGCGGGCCGGTGACGGCGCGTTCGTACCGGCGGTGGTGATCGGCACCGGTTAC
GGTGCGGCGGTCTCCGCGCTGCGGCTCGGCGAGGCGGGAATTCCGACGCTCATGCTCGAA
ATGGGCCAGCTGTGGAACAAGCCGGCCGACGACGGCAACATCTTCTGCGGAATGCTCAAG
CCCGACCGCAGGTCCAGCTGGTTCAAGTCGCGCACCGAAGCCCCGCTGGGCTCGTTCCTG
TGGCTGGATGTCATCAACCGCAACATCGACCCGTACGCGGGCGTCCTCGACAAGGTGCAC
TTCGACGAGATGTCGGTGTACGTGGGACGGGGCGTCGGCGGCGGCTCGCTGGTCAACGGC
GGCATGGCCGTCGTACCGAAGCGCTCGTACTTCGAAGAGGTCCTCCCACGGGTGGACGCC
GCCCAGATGTACGACCGGTACTTCCCGCGCGCCAACTCCATGCTCAAGGTGAACCACATC
GACAAGGGGTGGTTCGAGGACACGGAGTGGTACAAGTACGCGCGGGTCTCGCGCGAGCAG
GCGGGCAAGGCGGGCCTGAGCACCACCTTCGTCCCCAACGTCTACGACTTCGACCACATG
CGGCGCGAGGCGGACGGCACGGCGCCCAAGTCGGCGCTGGCCGGCGAGGTGATCTACGGC
AACAACCACGGCAAGCAGAGCCTGGACAAGACCTATCTGGCCGCCGCGCTGGGCACCGGC
AAGGTCACCATCGAGACGCTGCACCAGGTCAAGGCGATCCGGCGGCAGCCGGACGGCAGC
TATGTGCTGTCCGTGGTGCAGAGCGACGCCGACGGCAAGACCATCGCGCAGAAGGAGATC
GGCTGCCGCCACCTGTTCCTCGGCGCGGGCAGCCTCGGCTCCACCGAACTGCTGGTGCGC
GCCCGCGACACCGGCACGCTGCCCGAGCTGAACGCCGAGGTCGGCGCGGGCTGGGGCCCC
AACGGCAACATCATGACCGGCCGCGCCAACCACGTCTGGAACCCCACCGGGGCCCACCAG
TCCTCGATCCCCGCCCTGGGCATCGACGACTGGGACAACCCGGCAGCCCCGGTCTTCGCG
GAGATCGCGCCGATGCCGGCCGGCCTGGAGACCTGGGTCAGCCTCTACCTGGCGATCACC
AAGAACCCCGAGCGCGGCACCTTCGTCTACGACAAGGCCACCGACCGGGCCAAACTGCGC
TGGACCCGGGACCAGAACACCCCCGCGGTCAACGCCGCGAAGTCGCTGTTCGACCGGATC
AACAAGGCCAACACGACGATGTACCGCTACGACCTGTTCGGTTCGCAGCTGAAGAACTTC
TCCGACGACTTCAGCTACCACCCGCTCGGCGGCTGCGTCCTGGGCAAGGCCACCGACCTC
TACGGCCGCGTCGCCGGCTATCAGAACCTCTACGTCATGGACGGCGCGCTCGTGCCGGGC
TCCATCGGCGTCAACCCCTTCGTGACCATCACGGCCCTCGCCGAGCGCAACATCGAGCGG
ATCATCGCGGAGGACGTCAAGGCCGCGTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000172 Glucose-methanol-choline oxidoreductase, N-terminal (Domain)
 [146-340]  5.7e-06 PF00732
PF00732   GMC_oxred_N
 [149-172]  PS00623
PS00623   GMC_OXRED_1
IPR006311 Twin-arginine translocation pathway, signal sequence (Conserved_site)
 [1-37]  PS51318
PS51318   TAT
IPR007867 Glucose-methanol-choline oxidoreductase, C-terminal (Domain)
 [475-536]  2.4e-13 PF05199
PF05199   GMC_oxred_C
SignalP
 [1-37]  1 Signal
Bacteria, Gram-negative   
 [1-24]  0.743 Signal
Eukaryota   
 [1-37]  1 Signal
Bacteria, Gram-positive   
TMHMM
 [12-31]  Transmembrane (i-o)
Transmembrane 1