close all open/close all

CDS information : Rimoc_00040


close this sectionLocation

Organism
Strain108
Entry nameRimocidin
Contig
Start / Stop / Direction5,254 / 6,636 / + [in whole cluster]
5,254 / 6,636 / + [in contig]
Location5254..6636 [in whole cluster]
5254..6636 [in contig]
TypeCDS
Length1,383 bp (460 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productglycosyltransferase
Product (GenBank)RimE
Gene
Gene (GenBank)rimE
EC number
Keyword
  • mycosamine
Note
Note (GenBank)
  • glycosyl transferase
Reference
ACC
PmId
[15123265] Starter unit choice determines the production of two tetraene macrolides, rimocidin and CE-108, in Streptomyces diastaticus var. 108. (Chem Biol. , 2004)
[16242652] A tailoring activity is responsible for generating polyene amide derivatives in Streptomyces diastaticus var. 108. (Chem Biol. , 2005)
Family/Domain
FD
IPR002213

close this sectionSequence

selected fasta
>glycosyltransferase [RimE]
MESARRPILFVSLPEAGLANPLLVLAEELSRQDVPDLWFATDEPRREDVKKISVGSPVEF
ASLGEVVPELSAVTWGDEVYREVTQSSRFKAHRAVIRHSYVPRAQEEKFQKLAAVVDEIR
PALIVVDCISSYGVELAMARKIPYVLSVPFTPSNVLTAFTPFAKGYTPKDFPVPHTGLPY
PMNLPQRVRNMLFKLRTLAMFCNPTMSKVLAEDNRRRKAHGLGQMSPMARIDHADLVLCN
SIAELDYPFDIPEKFRMVGTMVPPLPEAEQEDELSRWLDEQPSVVYAGFGTITRLTREQV
HSMVEVARRLQGRHQVLWKLPSGQQHLLPPKESLPDNLRIENWVPSQLDVLAHPNVKLFF
THAGGNGYNEGVYFGKPLVVRPLWVDCYDQAVRGRDFGISLTLDRPRDLDVDDVVDKLTR
VLETPSFRENAERLGALQRAAGGRAAAAEVILGHPALARA
selected fasta
>glycosyltransferase [RimE]
ATGGAATCCGCCCGACGGCCGATCCTCTTCGTCAGTCTTCCGGAGGCCGGGCTGGCCAAT
CCGCTGCTCGTCCTGGCCGAGGAACTCTCCCGCCAAGACGTGCCGGATCTCTGGTTCGCC
ACCGACGAGCCGCGGCGCGAGGACGTGAAGAAGATTTCGGTGGGGTCTCCGGTGGAATTC
GCCTCACTGGGCGAGGTGGTCCCCGAACTGTCGGCCGTGACCTGGGGCGACGAGGTGTAC
CGGGAAGTCACCCAGTCGTCGCGGTTCAAGGCGCACCGCGCGGTGATCCGGCACTCGTAC
GTGCCCCGCGCGCAGGAGGAGAAGTTCCAGAAGCTCGCGGCCGTCGTCGACGAGATCCGG
CCGGCGCTGATCGTCGTCGACTGCATCAGTTCGTACGGCGTGGAGCTGGCCATGGCGCGG
AAGATCCCGTACGTGCTCAGCGTGCCGTTCACCCCGAGCAATGTGCTGACGGCGTTCACC
CCCTTCGCCAAGGGCTACACCCCGAAGGACTTCCCCGTACCGCACACGGGGCTGCCCTAT
CCGATGAATCTCCCGCAGCGGGTGCGCAACATGCTCTTCAAACTGCGGACCCTCGCGATG
TTCTGCAACCCCACGATGAGCAAGGTACTGGCCGAGGACAACCGGCGGCGCAAGGCGCAC
GGGCTCGGGCAGATGAGCCCGATGGCGCGGATCGACCACGCCGATCTGGTGCTGTGCAAT
TCCATCGCCGAGCTGGACTATCCCTTCGACATTCCGGAGAAGTTCCGGATGGTCGGCACG
ATGGTGCCGCCCCTGCCGGAGGCGGAGCAGGAGGACGAGCTCTCGCGGTGGCTGGACGAA
CAGCCCTCGGTCGTCTACGCGGGATTCGGAACCATCACCCGGCTCACCCGGGAACAGGTC
CATTCCATGGTCGAGGTGGCCCGCCGGCTCCAGGGGCGGCACCAGGTGCTGTGGAAACTG
CCCTCGGGACAGCAGCACCTGCTGCCGCCGAAGGAATCCCTGCCGGACAATCTCCGTATC
GAGAACTGGGTCCCTTCGCAGCTCGATGTCCTCGCGCATCCGAACGTGAAGCTGTTCTTC
ACCCACGCCGGCGGCAACGGCTACAACGAAGGCGTGTATTTCGGCAAGCCGCTCGTGGTA
CGGCCGCTGTGGGTGGACTGCTACGACCAGGCCGTACGCGGCCGGGATTTCGGCATCAGC
CTGACCCTCGACCGGCCCCGGGACCTCGATGTCGACGACGTCGTCGACAAGCTGACCCGA
GTGCTCGAAACCCCCTCCTTCCGCGAGAACGCGGAGCGGCTCGGCGCCCTGCAGCGTGCG
GCGGGCGGCCGTGCGGCCGCTGCCGAGGTGATCCTCGGACACCCGGCCCTGGCCCGGGCG
TAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002213 UDP-glucuronosyl/UDP-glucosyltransferase (Family)
 [111-438]  8.49999999999995e-29 PF00201
PF00201   UDPGT
SignalP
 [1-26]  0.891 Signal
Eukaryota   
 [1-26]  0.17 Signal
Bacteria, Gram-negative   
TMHMM No significant hit