close all open/close all

CDS information : Rimoc_00050


close this sectionLocation

Organism
Strain108
Entry nameRimocidin
Contig
Start / Stop / Direction6,690 / 7,748 / + [in whole cluster]
6,690 / 7,748 / + [in contig]
Location6690..7748 [in whole cluster]
6690..7748 [in contig]
TypeCDS
Length1,059 bp (352 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative GDP-3-keto-6-deoxy-D-mannose C-3 aminotransferase
Product (GenBank)RimF
Gene
Gene (GenBank)rimF
EC number2.6.1.-
Keyword
  • mycosamine
Note
Note (GenBank)
  • aminotransferase
Reference
ACC
PmId
[15123265] Starter unit choice determines the production of two tetraene macrolides, rimocidin and CE-108, in Streptomyces diastaticus var. 108. (Chem Biol. , 2004)
Related Reference
ACC
Q93NX0
NITE
Amph_00130
PmId
[16079135] Biosynthesis of amphotericin derivatives lacking exocyclic carboxyl groups. (J Biol Chem. , 2005)

close this sectionSequence

selected fasta
>putative GDP-3-keto-6-deoxy-D-mannose C-3 aminotransferase [RimF]
MSFKYPVSRPALEGNELAYLTGAVEDGWISSQGPMVGRFERAFADYNGIAHGVSCSSGTA
ALTLALRALGIGPGDEVIVPEFTMIASAWAVTYTGATPVFVDCGDDLNIDVTRIEEKITA
RTKAVMPVHIYGRRCDMDAIMDIAYQYNLRVVEDSAEAHGIRPVGDIACYSLFANKIITA
GEGGICLTDDPKLAGQMQHLRAMAFTKDHSFLHKKVAYNYRMTAMQAAVALAQTERLDDI
LEVRRGIEKRYDEGLADVPGITLMPPRDVLWMYDLRAERREELREFLAGESIETRLFFKP
MSRQPMYFHPDWPSLKANTFAEDGLYLPTHTGLTAGDQDFVIDRVRAFYGVG
selected fasta
>putative GDP-3-keto-6-deoxy-D-mannose C-3 aminotransferase [RimF]
ATGTCGTTCAAGTATCCCGTGTCCAGGCCCGCTCTGGAGGGCAACGAGCTGGCGTATCTG
ACCGGTGCCGTCGAGGACGGGTGGATTTCCTCCCAGGGCCCGATGGTCGGGCGGTTCGAG
CGTGCCTTCGCCGACTACAACGGCATCGCGCACGGCGTTTCCTGTTCCTCGGGAACGGCG
GCGCTCACCCTCGCGCTGCGGGCGCTGGGCATCGGCCCGGGGGACGAGGTCATCGTCCCG
GAATTCACGATGATCGCCTCGGCATGGGCGGTCACCTACACCGGCGCCACGCCCGTGTTC
GTGGACTGCGGGGACGACCTCAACATCGACGTCACCCGTATCGAGGAGAAGATCACGGCG
CGCACGAAGGCCGTGATGCCGGTGCACATCTACGGCCGGCGGTGCGACATGGACGCGATC
ATGGACATTGCGTACCAGTACAACCTGCGGGTCGTGGAGGACAGCGCCGAAGCGCACGGC
ATTCGGCCGGTCGGTGACATCGCGTGCTACTCGCTGTTCGCCAACAAAATCATCACGGCG
GGGGAGGGCGGTATCTGCCTCACCGACGACCCGAAACTCGCCGGGCAGATGCAGCACTTG
CGGGCCATGGCGTTCACCAAGGACCACAGTTTCCTGCACAAGAAGGTGGCGTACAACTAC
CGCATGACGGCCATGCAGGCCGCCGTCGCGCTCGCCCAGACCGAGCGCCTGGACGACATC
CTCGAAGTGCGCCGCGGAATCGAGAAGCGCTACGACGAGGGGCTGGCCGATGTCCCCGGT
ATCACGCTGATGCCGCCGCGGGACGTGCTGTGGATGTACGACCTGCGCGCCGAACGCCGC
GAGGAACTGCGGGAATTCCTGGCCGGGGAGTCCATCGAGACCCGGCTGTTCTTCAAGCCG
ATGAGCCGGCAGCCCATGTACTTCCACCCCGACTGGCCCTCGCTCAAGGCGAACACCTTC
GCCGAGGACGGACTGTACCTGCCCACCCACACCGGACTGACCGCCGGCGACCAGGACTTC
GTGATCGACCGGGTCCGCGCCTTCTACGGCGTCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000653 DegT/DnrJ/EryC1/StrS aminotransferase (Family)
 [12-346]  8.70000000000003e-101 PF01041
PF01041   DegT_DnrJ_EryC1
 [1-352]  3.99998544139406e-87 PIRSF000390
PIRSF000390   PLP_StrS
IPR015421 Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (Domain)
 [4-234]  3.70000000000004e-77 G3DSA:3.40.640.10
G3DSA:3.40.640.10   PyrdxlP-dep_Trfase_major_sub1
IPR015422 Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (Domain)
 [237-349]  3e-19 G3DSA:3.90.1150.10
G3DSA:3.90.1150.10   PyrdxlP-dep_Trfase_major_sub2
IPR015424 Pyridoxal phosphate-dependent transferase, major domain (Domain)
 [2-352]  6.90004508941104e-100 SSF53383
SSF53383   PyrdxlP-dep_Trfase_major
SignalP No significant hit
TMHMM No significant hit