close all open/close all

CDS information : Rimoc_00060


close this sectionLocation

Organism
Strain108
Entry nameRimocidin
Contig
Start / Stop / Direction7,777 / 9,039 / + [in whole cluster]
7,777 / 9,039 / + [in contig]
Location7777..9039 [in whole cluster]
7777..9039 [in contig]
TypeCDS
Length1,263 bp (420 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productcytochrome P450
Product (GenBank)RimG
Gene
Gene (GenBank)rimG
EC number
Keyword
  • C-14 carboxy group formation
Note
Note (GenBank)
  • cytochrome P450 monooxygenase
Reference
ACC
PmId
[15123265] Starter unit choice determines the production of two tetraene macrolides, rimocidin and CE-108, in Streptomyces diastaticus var. 108. (Chem Biol. , 2004)
[16242652] A tailoring activity is responsible for generating polyene amide derivatives in Streptomyces diastaticus var. 108. (Chem Biol. , 2005)
Related Reference
ACC
B3XWK3
PmId
[18640605] Increase in pladienolide D production rate using a Streptomyces strain overexpressing a cytochrome P450 gene. (J Biosci Bioeng. , 2008)

close this sectionSequence

selected fasta
>cytochrome P450 [RimG]
MTHTEPAAPATCPVTGATAGATDTTDSTGHGTDPLVVDFPLRAPGIPFPPPEYADYRDKK
GLVLSHLPDGKRVWLVTRHEDVRAVLTNPAISSNPQHPGFPNVGETIGVPRQDQIPGWFV
GMDSPEHDRFRKALIPEFTVRRVRAMKPAIERTVDAQLDAMLAAGNTADLVADFTLPIPS
LVISALLGVPPADREFFESRTRVLVSFRAYSDEDRLAAGKDLMRYINRLIEIKKNWGGDD
IVTRLLATGAIGAHEMSGVLMLLLIAGHETTANNIALGVVTLLKNPQWIGDERAVEETLR
FHSVADLVSLRVAVEDVEIAGQHIKAGEGIVPLVAAANHDEELFACPHAFDPSRSARGHV
AFGYGVHQCLGQNLVRVEMEVAYRKLFERIPNLRLDVPEDGLNIKYDGVLYGLHELPVRW
selected fasta
>cytochrome P450 [RimG]
ATGACGCACACCGAACCGGCCGCGCCGGCCACCTGCCCGGTCACGGGAGCGACGGCCGGG
GCCACGGACACGACGGATTCGACCGGGCACGGAACGGACCCGCTGGTCGTCGACTTTCCG
CTGCGCGCGCCCGGCATACCCTTCCCGCCGCCCGAATACGCCGATTACCGCGACAAGAAG
GGGCTGGTGCTCTCGCACCTGCCCGACGGCAAACGGGTGTGGCTGGTCACCCGGCACGAG
GACGTACGCGCCGTCCTGACCAACCCGGCCATCAGCTCCAACCCCCAGCACCCGGGCTTT
CCCAATGTCGGCGAGACGATCGGCGTACCCAGGCAGGACCAGATACCCGGCTGGTTCGTG
GGAATGGACTCGCCCGAACACGACCGGTTCCGCAAGGCCCTCATCCCGGAGTTCACCGTG
CGGCGCGTCCGCGCGATGAAACCCGCGATCGAGCGCACGGTGGACGCGCAACTGGACGCG
ATGCTGGCCGCGGGCAACACCGCCGACCTCGTCGCCGACTTCACCCTGCCCATTCCCTCC
CTGGTGATCTCGGCACTGCTCGGCGTGCCGCCCGCCGACCGCGAGTTCTTCGAATCCAGG
ACCCGCGTCCTGGTCTCGTTCCGTGCGTACTCCGACGAGGACCGCCTGGCCGCCGGCAAG
GACCTCATGCGGTACATCAACCGGCTGATCGAGATCAAGAAGAACTGGGGCGGCGACGAC
ATCGTCACCCGGCTGCTGGCCACCGGCGCCATCGGTGCCCACGAAATGTCCGGCGTACTG
ATGCTGCTGCTCATCGCCGGCCACGAGACCACGGCCAACAACATCGCGCTCGGTGTGGTC
ACCCTGCTGAAGAATCCCCAGTGGATCGGTGACGAACGGGCCGTCGAGGAAACCCTGCGC
TTCCACTCGGTCGCCGACCTGGTGTCCCTGCGGGTGGCCGTCGAGGACGTGGAGATCGCC
GGGCAGCACATCAAGGCGGGCGAGGGCATCGTGCCGCTGGTCGCCGCCGCCAATCACGAC
GAGGAACTCTTCGCGTGCCCCCACGCGTTCGACCCCTCCCGCTCCGCCCGCGGCCATGTG
GCCTTCGGCTACGGCGTACACCAGTGCCTGGGGCAGAACCTGGTACGGGTCGAGATGGAG
GTCGCGTACCGCAAGCTCTTCGAGCGCATTCCCAACCTCCGGCTCGACGTGCCCGAGGAC
GGACTGAACATCAAGTACGACGGCGTGCTCTACGGCCTGCACGAGCTGCCCGTCCGCTGG
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [266-283]  2.6999988713206e-08 PR00385 [293-304]  2.6999988713206e-08 PR00385 [360-369]  2.6999988713206e-08 PR00385 [369-380]  2.6999988713206e-08 PR00385
PR00385   P450
 [36-420]  1.19999063421924e-87 SSF48264
SSF48264   Cytochrome_P450
 [293-388]  1.3e-19 PF00067
PF00067   p450
 [36-420]  2.99999999999998e-95 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
IPR002397 Cytochrome P450, B-class (Family)
 [122-133]  8.69997440322062e-45 PR00359 [169-185]  8.69997440322062e-45 PR00359 [186-201]  8.69997440322062e-45 PR00359 [224-246]  8.69997440322062e-45 PR00359 [311-338]  8.69997440322062e-45 PR00359 [339-354]  8.69997440322062e-45 PR00359 [360-369]  8.69997440322062e-45 PR00359 [369-380]  8.69997440322062e-45 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [362-371]  PS00086
PS00086   CYTOCHROME_P450
SignalP
 [1-21]  0.667 Signal
Bacteria, Gram-negative   
 [1-21]  0.35 Signal
Bacteria, Gram-positive   
TMHMM No significant hit